Animal-Free IL-1 beta Protein, Mouse (His)

IL-1 beta Protein, a potent pro-inflammatory cytokine and major endogenous pyrogen, induces immune cell effects like prostaglandin synthesis, neutrophil activation, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation and synergizes with IL12 for Th1 IFNG synthesis. Contributing to angiogenesis, it induces VEGF production with TNF and IL6. Involved in pyroptosis, its mature form is released through the GSDMD pore. Existing as a monomer, IL-1 beta Protein interacts with MEFV, integrins, TMED10, HSP90AB1, and HSP90B1, facilitating cargo translocation into the ERGIC. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.3 kDa.

IL-1 beta Protein is a potent pro-inflammatory cytokine that was initially discovered as the major endogenous pyrogen. It has various effects on immune cells, such as inducing prostaglandin synthesis, activating neutrophils, promoting T-cell activation and cytokine production, stimulating B-cell activation and antibody production, and increasing fibroblast proliferation and collagen production. IL-1 beta Protein also plays a role in promoting the differentiation of Th17 cells and works synergistically with IL12 to induce the synthesis of IFNG by Th1 cells. Moreover, it contributes to angiogenesis by inducing VEGF production in collaboration with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular environment through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV, as well as integrins ITGAV:ITGBV and ITGA5:ITGB1, which are required for IL1B signaling. IL-1 beta Protein also interacts with the cargo receptor TMED10 and HSP90AB1 and HSP90B1, which facilitate the translocation of cargo into the ERGIC.

Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀ for this effect is< 8 pg/mL. The specific activity of recombinan tmouse IL-1 beta is approximately >1.2x 10⁸ IU/mg/.

Mouse

E. coli

C-His

P10749 (V118-S269)

16176  [NCBI]

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Approximately 18.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.