Animal-Free IL-11 Protein, Human (His)

IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. Animal-Free IL-11 Protein, Human (His) is the recombinant human-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

IL-11 Protein emerges as a multifaceted cytokine, orchestrating crucial biological processes. It stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, culminating in the maturation of megakaryocytes and augmented platelet production. Additionally, IL-11 plays a pivotal role in liver regeneration by promoting hepatocyte proliferation in response to damage. Its binding to a receptor complex, composed of IL6ST and IL11RA, initiates a signaling cascade that fuels cellular proliferation. This interaction activates intracellular protein kinases and triggers the phosphorylation of STAT3. Notably, IL-11 exhibits versatility in signaling modalities: it engages in 'classic signaling' upon interaction with membrane-bound IL11RA and IL6ST, and alternatively, it participates in 'trans-signaling' when binding to IL6ST in conjunction with soluble IL11RA. The intricate interplay of IL-11 and its receptors, IL11RA and IL6ST, forms a multimeric signaling complex with far-reaching implications for diverse physiological responses.

Measure by its ability to induce T11 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately >1 x 10⁷ IU/mg.

Human

E. coli

N-6*His

P20809 (P22-L199)

3589  [NCBI]

Full Length of Mature Protein

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.