Animal-Free IL-11 Protein, Human (His)
Based on 1 Customer Validation
IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. Animal-Free IL-11 Protein, Human (His) is the recombinant human-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. Animal-Free IL-11 Protein, Human (His) is the recombinant human-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background
IL-11 Protein emerges as a multifaceted cytokine, orchestrating crucial biological processes. It stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, culminating in the maturation of megakaryocytes and augmented platelet production. Additionally, IL-11 plays a pivotal role in liver regeneration by promoting hepatocyte proliferation in response to damage. Its binding to a receptor complex, composed of IL6ST and IL11RA, initiates a signaling cascade that fuels cellular proliferation. This interaction activates intracellular protein kinases and triggers the phosphorylation of STAT3. Notably, IL-11 exhibits versatility in signaling modalities: it engages in 'classic signaling' upon interaction with membrane-bound IL11RA and IL6ST, and alternatively, it participates in 'trans-signaling' when binding to IL6ST in conjunction with soluble IL11RA. The intricate interplay of IL-11 and its receptors, IL11RA and IL6ST, forms a multimeric signaling complex with far-reaching implications for diverse physiological responses.
Verified Bioactivity
Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately >1 x 107 IU/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P20809 (P22-L199)
-
Molecular Construction
-
N-term
-
6*His
-
IL-11 (P22-L199)
Accession # P20809 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL11; Adipogenesis Inhibitory Factor; Interleukin 11; Interleukin-11; IL-11; Oprelvekin; AGIF
-
AA Sequence
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
