Animal-Free IL-16 Protein, Human (His)

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

* Please select Quantity before adding items.

Species	Human
Source	E. coli
Tag	C-His
Accession	XP_047288413.1 (M593-S721)
Gene ID	3603 [NCBI]
Molecular Construction	N-term IL-16 (M593-S721) Accession # XP_047288413.1 His C-term
Synonyms	Pro-interleukin-16; Interleukin-16; IL-16; Lymphocyte chemoattractant factor; LCF
AA Sequence	MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Molecular Weight	Approximately 14.12 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Documentation	Data Sheet (232 KB) Handling Instructions (2659 KB)

Animal-Free IL-16 Protein, Human (His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.