Animal-Free IL-16 Protein, Human (His)
Based on 1 Customer Validation
Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Background
IL-16, a pleiotropic cytokine, is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines, such as TNF-α, IL1β, IL6, and IL15[1]. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. In addition, IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor[2].
IL-16 is constitutively expressed in a variety of cells, such as T cells, B cells, mast cells, eosinophils, and epithelial cells[2]. IL-16 is mainly produced by CD4+ and CD8+ cells as a precursor protein (pro-IL-16). Pro-IL-16 is enzymatically cleaved by caspase 3, inducing the release of bioactive mature form of IL-16[3]. Human IL-16 shares about 80% aa sequence identity with mouse.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
XP_047288413.1 (M593-S721)
-
Molecular Construction
-
N-term
-
IL-16 (M593-S721)
Accession # XP_047288413.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL16; FLJ42735; Interleukin 16; FLJ16806; Pro-Interleukin-16; IL-16; PrIL-16; Interleukin 16 (Lymphocyte Chemoattractant Factor); LCF; Neuronal Interleukin 16; Lymphocyte Chemoattractant Factor; IL16 Protein; Prointerleukin 16; PRIL16; HsT19289; NIL16
-
AA Sequence
MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
-
Predicted Molecular Mass
14.1 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a solution containing PBS, pH 8.0.
<0.1 EU/μg, determined by LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
