Copy Link Print Information

Animal-Free IL-17B Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells.Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis.Animal-Free IL-17B Protein, Human (His) is the recombinant human-derived animal-FreeIL-17B protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IL-17B Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells.Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis.Animal-Free IL-17B Protein, Human (His) is the recombinant human-derived animal-FreeIL-17B protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-17B protein plays a crucial role in cellular signaling by inducing the release of pro-inflammatory cytokines, specifically tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity highlights the protein's involvement in the regulation of immune responses and inflammatory processes, emphasizing its potential significance in mediating the crosstalk between immune cells and contributing to the overall immune homeostasis.

Verified Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <49 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q9UHF5 (Q21-F180)

  • Gene ID
    27190  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17B (Q21-F180)
      Accession # Q9UHF5
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17B; MGC138901; Interleukin 17B; Neuronal Interleukin-17 Related Factor; IL-17B; Cytokine-Like Protein ZCYTO7; ZCYTO7; Interleukin-17 Beta; IL-20; Cytokine Zcyto7; NIRF; Interleukin 20; Neuronal Interleukin-17-Related Factor; Interleukin-20; Interleukin

  • AA Sequence

    QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IL-17B Protein, Human (His) Product Image
    1/16
  • Animal-Free IL-17B Protein, Human (His) Product Image