Animal-Free IL-17B Protein, Human (His)

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells. Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis. Animal-Free IL-17B Protein, Human (His) is the recombinant human-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17B Protein, Human (His) is 160 a.a., with molecular weight of ~19.09 kDa.

IL-17B protein plays a crucial role in cellular signaling by inducing the release of pro-inflammatory cytokines, specifically tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity highlights the protein's involvement in the regulation of immune responses and inflammatory processes, emphasizing its potential significance in mediating the crosstalk between immune cells and contributing to the overall immune homeostasis.

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <49 ng/mL.

Human

E. coli

C-His

Q9UHF5 (Q21-F180)

27190  [NCBI]

MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Approximately 19.09 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.