1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-18
  5. Animal-Free IL-18 Protein, Mouse (His)

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. Animal-Free IL-18 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-18 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. Animal-Free IL-18 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-18 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Actividad biológica

Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <0.5 µg/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P70380 (N36-S192)

Gene ID
Molecular Construction
N-term
IL-18 (N36-S192)
Accession # P70380
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-18; Il18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; Igif
AA Sequence

NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Predicted Molecular Mass
19.1 kDa
Peso molecular

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Animal-Free IL-18 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Animal-Free IL-18 Protein, Mouse (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Animal-Free IL-18 Protein, Mouse (His)
Cat. No.:
HY-P70642AF
Cantidad:
MCE Japan Authorized Agent: