Animal-Free IL-21 Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-21, a cytokine endowed with immunoregulatory prowess, emerges as a key player in orchestrating the delicate transition between innate and adaptive immunity. This multifaceted regulator takes the stage in inducing the production of IgG(1) and IgG(3) in B-cells, thereby substantiating its pivotal role in shaping humoral immune responses. IL-21 finds its niche in fostering the generation and perpetuation of T follicular helper (Tfh) cells and the intricate formation of germinal centers. Collaborating synergistically with IL6, it exercises command over the early development of Tfh cells, contributing indispensably to a robust antibody response during acute viral infections. Beyond B-cells, IL-21 extends its influence to the realm of natural killer (NK) cells, where, in synergy with IL15, it fuels their proliferation and maturation. Further, IL-21 flexes its regulatory muscle, guiding the proliferation and maturation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it orchestrates the production of interferon-gamma in both T-cells and NK cells. Notably, during T-cell-mediated immune responses, IL-21 steps in as a potential inhibitor, dampening the activation and maturation of dendritic cells, unveiling a nuanced regulatory role in immune dynamics.

Verified Bioactivity

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is >1.6 x 105IU/mg

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-21 (H18-S146)
      Accession # Q9ES17
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL21; Interleukin-21; Interleukin 21; Interleukin; IL-21; CVID11; Za11

  • AA Sequence

    HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

  • Predicted Molecular Mass

    15.9 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00