Copy Link Print Information

Animal-Free IL-32 alpha Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IL-32 alpha Protein, a cytokine, potentially contributes to innate and adaptive immune responses. It induces TNFA/TNF-alpha and IL8, activating typical cytokine signal pathways, including NF-kappa-B and p38 MAPK. Animal-Free IL-32 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-32 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IL-32 alpha Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-32 alpha Protein, a cytokine, potentially contributes to innate and adaptive immune responses. It induces TNFA/TNF-alpha and IL8, activating typical cytokine signal pathways, including NF-kappa-B and p38 MAPK. Animal-Free IL-32 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-32 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-32 alpha protein, classified as a cytokine, is implicated in both innate and adaptive immune responses. This protein demonstrates the ability to induce the expression of various cytokines, including TNFA/TNF-alpha and IL8, thereby influencing the inflammatory milieu. Furthermore, the signaling pathways triggered by IL-32 alpha encompass the canonical pathways of NF-kappa-B and p38 MAPK, highlighting its involvement in orchestrating diverse cellular responses associated with immune regulation. This underscores the potential significance of IL-32 alpha in the intricate network of immune signaling cascades, contributing to the modulation of inflammatory and immune processes.

Verified Bioactivity

Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED50 for this effect is <10 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P24001-4 (M1-K131)

  • Gene ID
    9235  [NCBI]
  • Molecular Construction
    • N-term
    • IL-32α (M1-K131)
      Accession # P24001-4
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    IL32; Interleukin-32; Interleukin 32; Interleukin-32 Small; TAIF; Interleukin-32 Eta; NK4; IL-32alpha; TAIFb; IL-32delta; TAIFd; IL-32gamma; Tumor Necrosis Factor Alpha-Inducing Factor; IL-32beta; Natural Killer Cell Transcript 4; TAIFa; Natural Killer Ce

  • AA Sequence

    MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

  • Predicted Molecular Mass

    15.7 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IL-32 alpha Protein, Human (His) Product Image
    1/16
  • Animal-Free IL-32 alpha Protein, Human (His) Product Image