Copy Link Print Information

Animal-Free MCP-1/CCL2 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free MCP-1/CCL2 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Background

MCP-1/CCL2 protein acts as a ligand for C-C chemokine receptor CCR2, initiating a robust chemotactic response and intracellular calcium mobilization through CCR2 binding and activation. It demonstrates chemotactic activity for monocytes and basophils while not affecting neutrophils or eosinophils. Playing a pivotal role in mediating peripheral nerve injury-induced neuropathic pain, MCP-1/CCL2 also enhances NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, potentially involving MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Existing as a monomer or homodimer in equilibrium, it is tethered to endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans and interacts with TNFAIP6 through its Link domain.

Verified Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED50 for this effect is <8 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    P10148 (Q24-N148)

  • Gene ID
    20296  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • CCL2 (Q24-N148)
      Accession # P10148
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL2; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 2; Prev. SCYA2; Chemokine (C-C Motif) Ligand 2; MCP-1; Monocyte Chemotactic Protein 1; MCP1; Small-Inducible Cytokine A2; MCAF; C-C Motif Chemokine 2; HC11; MGC9434; Monocyte Chemotactic And Act

  • AA Sequence

    QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

  • Predicted Molecular Mass

    14.7 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free MCP-1/CCL2 Protein, Mouse (His) Product Image
    1/16
  • Animal-Free MCP-1/CCL2 Protein, Mouse (His) Product Image