Animal-Free PF-4/CXCL4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The PF-4/CXCL4 protein released during platelet aggregation has a crucial impact on physiological processes. It neutralizes the anticoagulant effect of heparin with higher affinity than chondroitin 4-sulfate chains. Animal-Free PF-4/CXCL4 Protein, Human (His) is the recombinant human-derived animal-FreePF-4/CXCL4 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PF-4/CXCL4 protein released during platelet aggregation has a crucial impact on physiological processes. It neutralizes the anticoagulant effect of heparin with higher affinity than chondroitin 4-sulfate chains. Animal-Free PF-4/CXCL4 Protein, Human (His) is the recombinant human-derived animal-FreePF-4/CXCL4 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

PF-4/CXCL4 protein, released during platelet aggregation, plays a pivotal role in various physiological processes. It acts to neutralize the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Furthermore, PF-4 demonstrates chemotactic properties, attracting neutrophils and monocytes, thereby contributing to immune responses. Notably, it also functions as an inhibitor of endothelial cell proliferation, with the shorter form displaying greater potency than the longer variant. Structurally, PF-4 forms a homotetramer, as evidenced by studies. Additionally, it engages with TNFAIP6 through its Link domain, emphasizing its involvement in intricate molecular interactions. This multifaceted functionality underscores the importance of PF-4/CXCL4 in regulating hemostasis, immune responses, and vascular processes.

Verified Bioactivity

Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED50 for this effect is <5 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CXCL4 (E32-S101)
      Accession # P02776
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PF4; C-X-C Motif Chemokine 4; Platelet Factor 4; Oncostatin-A; SCYB4; Iroplact; CXCL4; PF-4; Chemokine (C-X-C Motif) Ligand 4

  • AA Sequence

    EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

  • Predicted Molecular Mass

    8.6 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00