Animal-Free PF-4/CXCL4 Protein, Human (His)

The PF-4/CXCL4 protein released during platelet aggregation has a crucial impact on physiological processes. It neutralizes the anticoagulant effect of heparin with higher affinity than chondroitin 4-sulfate chains. Animal-Free PF-4/CXCL4 Protein, Human (His) is the recombinant human-derived animal-FreePF-4/CXCL4 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free PF-4/CXCL4 Protein, Human (His) is 70 a.a., with molecular weight of ~8.58 kDa.

PF-4/CXCL4 protein, released during platelet aggregation, plays a pivotal role in various physiological processes. It acts to neutralize the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Furthermore, PF-4 demonstrates chemotactic properties, attracting neutrophils and monocytes, thereby contributing to immune responses. Notably, it also functions as an inhibitor of endothelial cell proliferation, with the shorter form displaying greater potency than the longer variant. Structurally, PF-4 forms a homotetramer, as evidenced by studies. Additionally, it engages with TNFAIP6 through its Link domain, emphasizing its involvement in intricate molecular interactions. This multifaceted functionality underscores the importance of PF-4/CXCL4 in regulating hemostasis, immune responses, and vascular processes.

Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED₅₀ for this effect is <5 μg/mL.

Human

E. coli

N-His

P02776 (E32-S101)

5196  [NCBI]

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Approximately 8.58 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.