Animal-Free TRAIL/TNFSF10 Protein, Mouse (His)

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.Animal-Free TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTRAIL/TNFSF10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

The TRAIL/TNFSF10 protein, a cytokine, binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly TNFRSF11B/OPG, inducing apoptosis. Its apoptotic activity may be modulated by binding to decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG, which lack the ability to induce apoptosis. TRAIL/TNFSF10 exists as a homotrimer, where one TRAIL/TNFSF10 homotrimer interacts with three TNFRSF10A monomers and another homotrimer interacts with three TNFRSF10B monomers. This multivalent interaction underscores the intricate molecular interactions governing the apoptotic signaling pathways mediated by TRAIL/TNFSF10 and its receptors.

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <1 ng/mL.

Mouse

E. coli

C-6*His

P50592 (P118-N291)

22035  [NCBI]

Partial

PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.