Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag.

Background

APOE is an apolipoprotein that plays a crucial role in lipid transport between organs through plasma and interstitial fluids. It is a key component of plasma lipoproteins and is involved in their production, conversion, and clearance. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. Additionally, it binds to a range of cellular receptors, such as LDL receptor/LDLR and VLDL receptor/VLDLR, facilitating the cellular uptake of APOE-containing lipoproteins. APOE also possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. Notably, APOE forms a homotetramer and interacts functionally with ABCA1 in the biogenesis of HDLs. It may also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, as well as PMEL to induce fibril nucleation on intraluminal vesicles.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APOE (E19-Q311)
      Accession # P08226
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5

  • AA Sequence

    EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

  • Predicted Molecular Mass

    60.7 kDa

  • Molecular Weight

    Approximately 62-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00