Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag.
Background
APOE is an apolipoprotein that plays a crucial role in lipid transport between organs through plasma and interstitial fluids. It is a key component of plasma lipoproteins and is involved in their production, conversion, and clearance. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a preference for HDL. Additionally, it binds to a range of cellular receptors, such as LDL receptor/LDLR and VLDL receptor/VLDLR, facilitating the cellular uptake of APOE-containing lipoproteins. APOE also possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. Notably, APOE forms a homotetramer and interacts functionally with ABCA1 in the biogenesis of HDLs. It may also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, and secreted SORL1 in the cerebrospinal fluid, as well as PMEL to induce fibril nucleation on intraluminal vesicles.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P08226 (E19-Q311)
-
Molecular Construction
-
N-term
-
APOE (E19-Q311)
Accession # P08226 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5
-
AA Sequence
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
-
Predicted Molecular Mass
60.7 kDa
-
Molecular Weight
Approximately 62-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)