ARP3/ACTR3 Protein, Human (sf9, His-GST)

The ARP3/ACTR3 protein is an ATPase that is preferentially stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Independent of its ATPase function, it exhibits DNA-binding activity. ARP3/ACTR3 Protein, Human (sf9, His-GST) is the recombinant human-derived ARP3/ACTR3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

SWSAP1 is an ATPase preferentially stimulated by single-stranded DNA, playing a crucial role in homologous recombination repair (HRR). This protein exhibits DNA-binding activity independent of its ATPase function. It forms a functional complex with ZSWIM7, contributing to homologous recombination repair and mutual stabilization of the proteins. SWSAP1 also interacts with key players in the homologous recombination repair process, including RAD51, RAD51B, RAD51C, RAD51D, and XRCC3. These interactions highlight the involvement of SWSAP1 in facilitating the repair of DNA through homologous recombination mechanisms.

Human

Sf9 insect cells

N-His;N-GST

P61158 (A2-S418)

10096  [NCBI]

Full Length of Mature Protein

AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Approximately 75.1 kDa.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 3 mM DTT, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.