ARP3/ACTR3 Protein, Human (sf9, His-GST)
Based on 1 Customer Validation
The ARP3/ACTR3 protein is an ATPase that is preferentially stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Independent of its ATPase function, it exhibits DNA-binding activity. ARP3/ACTR3 Protein, Human (sf9, His-GST) is the recombinant human-derived ARP3/ACTR3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ARP3/ACTR3 protein is an ATPase that is preferentially stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Independent of its ATPase function, it exhibits DNA-binding activity. ARP3/ACTR3 Protein, Human (sf9, His-GST) is the recombinant human-derived ARP3/ACTR3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
SWSAP1 is an ATPase preferentially stimulated by single-stranded DNA, playing a crucial role in homologous recombination repair (HRR). This protein exhibits DNA-binding activity independent of its ATPase function. It forms a functional complex with ZSWIM7, contributing to homologous recombination repair and mutual stabilization of the proteins. SWSAP1 also interacts with key players in the homologous recombination repair process, including RAD51, RAD51B, RAD51C, RAD51D, and XRCC3. These interactions highlight the involvement of SWSAP1 in facilitating the repair of DNA through homologous recombination mechanisms.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P61158 (A2-S418)
-
Molecular Construction
-
N-term
-
His-GST
-
ARP3 (A2-S418)
Accession # P61158 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ACTR3; CDNA, FLJ79295, Highly Similar To Actin-Like Protein 3; Actin Related Protein 3; CDNA, FLJ79112, Highly Similar To Actin-Like Protein 3; ARP3; CDNA FLJ52434, Highly Similar To Actin-Like Protein 3; ARP3 Actin Related Protein 3 Homolog; CDNA FLJ5114
-
AA Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
-
Predicted Molecular Mass
75.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 3 mM DTT, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
