Copy Link Print Information

Azurocidin Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Azurocidin Protein, Human (HEK293, His), a recombinant human Azurocidin produced in HEK293 cells, has a His tag. Azurocidin is a protein that is mobilized rapidly from emigrating polymorphonuclear leukocytes (PMN). Azurocidin serves as an important mediator during the initiation of the immune response.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Azurocidin Protein, Human (HEK293, His)
  • Experimental Validation Results for Azurocidin Protein, Human (HEK293, His)
  • Azurocidin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Azurocidin Protein, Human (HEK293, His), a recombinant human Azurocidin produced in HEK293 cells, has a His tag. Azurocidin is a protein that is mobilized rapidly from emigrating polymorphonuclear leukocytes (PMN). Azurocidin serves as an important mediator during the initiation of the immune response[1].

Background

Azurocidin, released from PMN secretory vesicles or primary granules, acts as a chemoattractant and activator of monocyte and macrophages. The functional consequence is enhancement of cytokine release and bacterial phagocytosis, allowing for a more efficient bacterial clearance. Leukocyte activation by Azurocidin is mediated via β2-integrins, and Azurocidin-induced chemotaxis is dependent on formyl-peptide receptors. In addition, Azurocidin activates endothelial cells leading to vascular leakage and edema formation. For these reasons, targeting azurocidin release and its actions may have therapeutic potential in inflammatory disease conditions[1].

Verified Bioactivity

Measured by its ability to enhance LPS-induced TNF-alpha secretion from THP-1 cells. The ED50 for this effect is ≤1.315 μg/mL in the presence of 2 μg/mL LPS.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance LPS-induced TNF-alpha secretion from THP-1 cells. The ED50 for this effect is 1.061 μg/mL in the presence of 2 μg/mL LPS, corresponding to a specific activity is 942.507 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P20160 (I27-P250)

  • Gene ID
    566  [NCBI]
  • Molecular Construction
    • N-term
    • Azurocidin (I27-P250)
      Accession # P20160
    • 6*His
    • C-term
  • Protein Length

    Full Length of Azurocidin chain (with Propeptide)

  • Synonyms

    AZU1; CAP37; Azurocidin 1; AZAMP; Heparin-Binding Protein; NAZC; HBP; AZU; Cationic Antimicrobial Protein CAP37; Cationic Antimicrobial Protein 37; Azurocidin; Neutrophil Azurocidin; HUMAZUR; HHBP

  • AA Sequence

    IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP

  • Molecular Weight

    Approximately 34-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.5.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Oliver Soehnlein, et al. Neutrophil-derived azurocidin alarms the immune system. J Leukoc Biol. 2009 Mar;85(3):344-51. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to enhance LPS-induced TNF-alpha secretion from THP-1 cells. The ED50 for this effect is 1.061 μg/mL in the presence of 2 μg/mL LPS, corresponding to a specific activity is 942.507 U/mg.

  • Azurocidin Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Azurocidin Protein, Human (HEK293, His)
  • Experimental Validation Results for Azurocidin Protein, Human (HEK293, His)
  • Azurocidin Protein, Human (HEK293, His) Product Image