1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. B3GALT5 Protein, Human (HEK293, Fc)

B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GALT5 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GALT5 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Beta-1,3-Galactosyltransferase 5 (B3GALT5) is an enzyme that plays a key role in glycosylation by catalyzing the transfer of a galactose (Gal) residue to GlcNAc-based acceptors. This enzyme exhibits a preference for the core3 O-linked glycan structure, specifically GlcNAc(beta1,3)GalNAc. Additionally, B3GALT5 demonstrates efficiency in using glycolipid LC3Cer as an acceptor substrate. The transfer of galactose by B3GALT5 is integral to the biosynthesis of complex glycan structures, contributing to the diversity of glycoconjugates involved in cellular recognition, signaling, and adhesion processes. Understanding the substrate specificity of B3GALT5 provides insights into its role in glycosylation pathways and the modulation of cellular functions through the generation of specific glycan structures.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9Y2C3 (N29-V310)

Gene ID
Molecular Construction
N-term
hFc
B3GALT5 (N29-V310)
Accession # Q9Y2C3
C-term
Protein Length

Lumenal Domain

Synonyms
Beta-1,3-galactosyltransferase 5; Beta3Gal-T5; Beta-3-Gx-T5
AA Sequence

NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV

Predicted Molecular Mass
61.3 kDa
Molecular Weight

Approximately 62 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

B3GALT5 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

B3GALT5 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B3GALT5 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76738
Quantity:
MCE Japan Authorized Agent: