B3GALT5 Protein, Human (HEK293, Fc)
B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GALT5 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B3GALT5 protein plays a pivotal role in catalyzing the transfer of galactose (Gal) to GlcNAc-based acceptors, exhibiting a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Additionally, it demonstrates efficient acceptor activity with glycolipid LC3Cer. B3GALT5 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GALT5 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
Beta-1,3-Galactosyltransferase 5 (B3GALT5) is an enzyme that plays a key role in glycosylation by catalyzing the transfer of a galactose (Gal) residue to GlcNAc-based acceptors. This enzyme exhibits a preference for the core3 O-linked glycan structure, specifically GlcNAc(beta1,3)GalNAc. Additionally, B3GALT5 demonstrates efficiency in using glycolipid LC3Cer as an acceptor substrate. The transfer of galactose by B3GALT5 is integral to the biosynthesis of complex glycan structures, contributing to the diversity of glycoconjugates involved in cellular recognition, signaling, and adhesion processes. Understanding the substrate specificity of B3GALT5 provides insights into its role in glycosylation pathways and the modulation of cellular functions through the generation of specific glycan structures.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9Y2C3 (N29-V310)
-
Molecular Construction
-
N-term
-
hFc
-
B3GALT5 (N29-V310)
Accession # Q9Y2C3 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
B3GALT5; Beta-1,3-GalTase 5; Beta-1,3-Galactosyltransferase 5; Beta-3-Gx-T5; Beta3Gal-T5; UDP-Gal:Beta-GlcNAc Beta-1,3-Galactosyltransferase 5; B3GalT-V; UDP-Gal:BetaGlcNAc Beta 1,3-Galactosyltransferase 5; GLCT5; GlcNAc-Beta-1,3-Galactosyltransferase 5;
-
AA Sequence
NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV
-
Predicted Molecular Mass
61.3 kDa
-
Molecular Weight
Approximately 62 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
