B7-2/CD86 Protein, Human (Biotinylated, HEK293, Fc-Avi)
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of B7-2/CD86 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 222 a.a., with molecular weight of 66-100 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of B7-2/CD86 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 222 a.a., with molecular weight of 66-100 kDa.
Background
B7-2/CD86 protein functions as a negative regulator of T-cell activation by disrupting the formation of CD86 clusters. Through this interference, it modulates the T-cell response and plays a role in regulating immune activation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
P42081-1 (L26-P247)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD86; FUN-1; Prev. CD28LG2; B70; T-Lymphocyte Activation Antigen CD86; B-Lymphocyte Activation Antigen B7-2; B7.2; B-Lymphocyte Antigen B7-2; B7-2; CD86 Antigen; CD86 Antigen (CD28 Antigen Ligand 2, B7-2 Antigen); CD86 V6; CTLA-4 Counter-Receptor B7.2; LA
-
AA Sequence
LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
-
Predicted Molecular Mass
53.8 kDa
-
Molecular Weight
Approximately 66-90 kDa under reduced (R) conditions, 130-150 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
