B7-2/CD86 Protein, Mouse (HEK293, Fc)

B7-2/CD86 Protein, Mouse (HEK293, Fc), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

B7-2/CD86 Protein, Mouse (HEK293, Fc), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].

Background

The inhibition of CD28 interactions with B7-2 molecules may represent a novel therapeutic target for the treatment of lung mucosal allergic inflammation. B7-2, but not B7-1, is upregulated on lung B cells after allergen provocation[1][2].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Fc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • B7-2 (V26-E245)
      Accession # P42082
    • Fc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD86; FUN-1; Prev. CD28LG2; B70; T-Lymphocyte Activation Antigen CD86; B-Lymphocyte Activation Antigen B7-2; B7.2; B-Lymphocyte Antigen B7-2; B7-2; CD86 Antigen; CD86 Antigen (CD28 Antigen Ligand 2, B7-2 Antigen); CD86 V6; CTLA-4 Counter-Receptor B7.2; LA

  • AA Sequence

    VETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

  • Predicted Molecular Mass

    52.2 kDa

  • Molecular Weight

    Approximately 68-95 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00