B7-2/CD86 Protein, Mouse (HEK293, Fc)

B7-2/CD86 Protein, Mouse (HEK293, Fc), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation^[1][2].

The inhibition of CD28 interactions with B7-2 molecules may represent a novel therapeutic target for the treatment of lung mucosal allergic inflammation. B7-2, but not B7-1, is upregulated on lung B cells after allergen provocation^[1][2].

Mouse

HEK293

C-Fc

P42082 (V26-E245)

12524  [NCBI]

Partial

VETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

Approximately 68-95 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180(2):631-40.  [Content Brief]

  [2]. S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185(9):1671-9.  [Content Brief]