1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H2/ICOSLG B7-H2/CD275
  5. B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi)

B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78075
Handling Instructions Technical Support

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

B7-H2/ICOSLG protein serves as a ligand for the T-cell-specific cell surface receptor ICOS, functioning as a critical costimulatory signal for T-cell proliferation and cytokine secretion. Additionally, it induces B-cell proliferation and facilitates their differentiation into plasma cells. This protein is poised to play a significant role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, B7-H2/ICOSLG has been shown to interact with CTLA4 in vitro.

Biological Activity

1. Immobilized Biotinylated Human B7-H2 His at 0.5 μg/mL (100 μL/Well) on the plate. Dose response curve for Human ICOS hFc with the EC50 of 21.1 ng/mL determined by ELISA.
2. Immobilized Human ICOS (C136S,C137S) , His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human B7-H2, His Tag with the EC50 of 104.0 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

O75144-1 (D19-S258)

Gene ID
Molecular Construction
N-term
B7-H2/ICOSLG (D19-S258)
Accession # O75144-1
8*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
CD275; B7H2; B7-H2; B7RP-1; GL50; ICOSL; ICOS-L; ICOSLG; B7RP1; LICOS; ICOS ligand; B7-H2B7-related protein 1; B7RP-1; B7RP1B7-like protein Gl50
AA Sequence

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

분자량

55-70 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78075
수량:
MCE Japan Authorized Agent: