Copy Link Print Information

B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B7-H2/ICOSLG Protein, a ligand for T-cell receptor ICOS, critically costimulates T-cell proliferation and cytokine secretion. It induces B-cell proliferation and supports plasma cell differentiation, playing a key role in local tissue responses to inflammation. B7-H2/ICOSLG also modulates the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, it has been observed to interact with CTLA4 in vitro. B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived B7-H2/ICOSLG protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

B7-H2/ICOSLG protein serves as a ligand for the T-cell-specific cell surface receptor ICOS, functioning as a critical costimulatory signal for T-cell proliferation and cytokine secretion. Additionally, it induces B-cell proliferation and facilitates their differentiation into plasma cells. This protein is poised to play a significant role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. In molecular interactions, B7-H2/ICOSLG has been shown to interact with CTLA4 in vitro.

Verified Bioactivity

1. Immobilized Biotinylated Human B7-H2 His at 0.5 μg/mL (100 μL/Well) on the plate. Dose response curve for Human ICOS hFc with the EC50 of 21.1 ng/mL determined by ELISA.
2. Immobilized Human ICOS (C136S,C137S) , His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human B7-H2, His Tag with the EC50 of 104.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    O75144-1 (D19-S258)

  • Gene ID
    23308  [NCBI]
  • Molecular Construction
    • N-term
    • B7-H2/ICOSLG (D19-S258)
      Accession # O75144-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    ICOSLG; KIAA0653; Prev. ICOSL; CD275; B7-Related Protein 1; GL50; B7 Homolog 2; B7h; B7RP-1; B7 Homologue 2; B7RP1; Transmembrane Protein B7-H2 ICOS Ligand; B7-H2; Inducible T-Cell Costimulator Ligand; B7H2; CD275 Antigen; B7-Like Protein Gl50; IMD119; IC

  • AA Sequence

    DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

  • Predicted Molecular Mass

    29.5 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • B7-H2/ICOSLG Protein, Human (Biotinylated, HEK293, His-Avi) Product Image