Copy Link Print Information

B7-H4 Protein, Mouse (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • B7-H4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H4 protein serves as a negative regulator of the T-cell-mediated immune response by suppressing T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Its significance is particularly pronounced when expressed on the cell surface of tumor macrophages, where it collaborates with regulatory T-cells (Treg) to play a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Beyond its immunomodulatory functions, B7-H4 is also implicated in promoting epithelial cell transformation, highlighting its involvement in diverse cellular processes associated with immune regulation and tumorigenesis.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q7TSP5-1 (F29-S256)

  • Gene ID
    242122  [NCBI]
  • Molecular Construction
    • N-term
    • B7-H4 (F29-S256)
      Accession # Q7TSP5-1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    VTCN1; V-Set Domain Containing T Cell Activation Inhibitor 1; B7-H4; B7H4; B7h.5; B7S1; B7x; V-Set Domain-Containing T-Cell Activation Inhibitor 1; Immune Costimulatory Protein B7-H4; B7 Superfamily Member 1; B7 Family Member, H4; B7 Homolog 4; FLJ22418; T Cell Costimulatory Molecule B7x; T-Cell Costimulatory Molecule B7x; Protein B7S1; PRO1291; VCTN1

  • AA Sequence

    FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNS

  • Predicted Molecular Mass

    26.6 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • B7-H4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • B7-H4 Protein, Mouse (HEK293, His) Product Image