B7-H4 Protein, Mouse (HEK293, His)

The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

B7-H4 protein serves as a negative regulator of the T-cell-mediated immune response by suppressing T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Its significance is particularly pronounced when expressed on the cell surface of tumor macrophages, where it collaborates with regulatory T-cells (Treg) to play a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Beyond its immunomodulatory functions, B7-H4 is also implicated in promoting epithelial cell transformation, highlighting its involvement in diverse cellular processes associated with immune regulation and tumorigenesis.

Mouse

HEK293

C-His

Q7TSP5 (F29-S256)

242122  [NCBI]

Partial

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNS

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.