B7-H6 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

B7-H6 Protein is a member of B7 family that serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors. In addition, B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

B7-H6 Protein is a member of B7 family that serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors. In addition, B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H6, a member of B7 family, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms. B7-H6 has unique immunogenic properties, is a ligand of NKp30, which is an activating receptor of natural killer (NK) cells. High expression of B7-H6 is found in certain types of tumor cells, such as lymphoma, leukemia and gastric carcinoma. The expression of B7-H6 can be induced by inflammatory stress in healthy cells. In addition, B7‐H6 enhances the initiation of “caspase cascades” and anti-apoptosis role to provoke tumorigenesis via the STAT3 activation. B7‐H6 promotes tumor proliferation and G0/G1 cycle process by regulating the downstream apoptosis suppressors survivin, Mcl‐1, Bcl‐2, and Bcl‐xL. It induces cellular cytotoxicity, TNF-α and IFN-γ secretion by mediating IL-6 expression and B7-H6-specific BiTE triggers T cell to facilitate tumorigenesis. All these molecular mechanisms are involved in B7-H6-induced tumorigenesis[1].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human NCR3 (HY-P77811) at 5 μg/mL can bind Cynomolgus B7-H6. The ED50 for this effect is 1.543 μg/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • B7-H6 (D25-D259)
      Accession # XP_005578557
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NCR3LG1; B7 Homolog 6; Natural Killer Cell Cytotoxicity Receptor 3 Ligand 1; Natural Cytotoxicity Triggering Receptor 3 Ligand 1; B7-H6; B7H6; DKFZp686O24166; Putative Ig-Like Domain-Containing Protein DKFZp686O24166/DKFZp686I21167

  • AA Sequence

    DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD

  • Molecular Weight

    Approximately 38-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00