Copy Link Print Information

BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

BAFF/TNFSF13B protein is a member of the TNF family and regulates immune responses and cell survival. It is also known as B cell activating factor, which plays a vital role in the development, activation and survival of B cells by binding to receptors such as BAFF-R. BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi)
  • Experimental Validation Results for BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi)
  • BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BAFF/TNFSF13B protein is a member of the TNF family and regulates immune responses and cell survival. It is also known as B cell activating factor, which plays a vital role in the development, activation and survival of B cells by binding to receptors such as BAFF-R. BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

The BAFF/TNFSF13B protein belongs to the tumor necrosis factor (TNF) family, a group of cytokines involved in regulating immune responses and cell survival. BAFF/TNFSF13B, also known as B-cell activating factor, plays a crucial role in B-cell development, activation, and survival. It binds to its receptors, including BAFF receptor (BAFF-R), and promotes B-cell proliferation, antibody production, and the maintenance of mature B cells. BAFF/TNFSF13B is particularly important in the development and function of the immune system, as it helps to regulate B-cell homeostasis and immune tolerance. Dysregulation of BAFF/TNFSF13B signaling has been implicated in various autoimmune diseases and B-cell malignancies. Understanding the role of BAFF/TNFSF13B in normal physiology and disease pathology can provide valuable insights into potential therapeutic approaches for conditions involving B-cell dysfunction or dysregulation.

Verified Bioactivity

1. Immobilized Cynomolgus BAFF Trimer, His Tag at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Human BAFFR, hFc Tag with the EC50 of ≤50 ng/mL determined by ELISA.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus BAFF at 2µg/mL (100µL/well) can bind Biotinylated Recombinant Human BAFFR (HY-P7130). The ED50 for this effect is 20-50 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus BAFF at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human BAFFR (HY-P7130). The ED50 for this effect is 29.52 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-Avi;N-6*His
  • Accession

    A0A2K5V2X4 (T141-L285)

  • Gene ID
    102123214  [NCBI]
  • Protein Length

    Partial

  • Synonyms

    TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis

  • AA Sequence

    TVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

  • Predicted Molecular Mass

    54.2 kDa

  • Molecular Weight

    Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus BAFF at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human BAFFR (HY-P7130). The ED50 for this effect is 29.52 ng/mL.

  • BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi) Product Image
    1/16
  • Experimental Validation Results for BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi)
  • Experimental Validation Results for BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi)
  • BAFF/TNFSF13B Trimer Protein, Cynomolgus (HEK293, His-Avi) Product Image