FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His-Avi)

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His-Avi) is the recombinant human-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.

Human

HEK293

C-Avi;C-8*His

Q02223 (M1-A54)

608  [NCBI]

Extracellular Domain

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Approximately 12 kDa and 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.