FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His-Avi)
BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His-Avi) is the recombinant human-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. FITC-labeled BCMA/TNFRSF17 Protein, Human (HEK293, His-Avi) is the recombinant human-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q02223 (M1-A54)
-
Molecular Construction
-
N-term
-
BCMA (M1-A54)
Accession # Q02223 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF17; TNFRSF13A; Prev. BCMA; Tumor Necrosis Factor Receptor Superfamily, Member 17; BCM; B Cell Maturation Antigen; Tumor Necrosis Factor Receptor Superfamily Member 17; B-Cell Maturation Factor; B-Cell Maturation Protein; CD269 Antigen; TNF Receptor
-
AA Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
-
Predicted Molecular Mass
8.9 kDa
-
Molecular Weight
Approximately 12 kDa & 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
