BGLAP Protein, Rat (GST)

Customer Review

Based on 1 Customer Validation

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

Background

BGLAP protein, in its carboxylated form, plays a crucial role in the bone matrix by acting as a negative regulator of bone formation while maintaining bone resorption and mineralization. This form exhibits strong binding affinity to apatite and calcium. On the other hand, the uncarboxylated form functions as a hormone secreted by osteoblasts and regulates various cellular processes including energy metabolism, male fertility, and brain development. In terms of energy metabolism, it promotes pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Additionally, the uncarboxylated osteocalcin hormone stimulates testosterone production in the testes by acting as a ligand for G protein-coupled receptor GPRC6A on Leydig cells, resulting in the activation of CREB-dependent pathways required for testosterone synthesis. Furthermore, this hormone serves as a regulator of brain development by crossing the blood-brain barrier and binding to GPR158 on neurons. This interaction prevents neuronal apoptosis in the hippocampus, promotes the synthesis of monoamine neurotransmitters, and inhibits the synthesis of gamma-aminobutyric acid (GABA). Notably, osteocalcin also crosses the placenta during pregnancy, and maternal osteocalcin is necessary for fetal brain development.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • BGLAP (Y50-V99)
      Accession # P04640
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BGLAP; BGP; Bone Gamma-Carboxyglutamate Protein; Bone Gla Protein; Gamma-Carboxyglutamic Acid-Containing Protein; Bone Gamma-Carboxyglutamate (Gla) Protein (Osteocalcin); Osteocalcin; Bone Gamma-Carboxyglutamate (Gla) Protein; OCN; OC

  • AA Sequence

    YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

  • Predicted Molecular Mass

    32.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00