BGLAP Protein, Rat (GST)
Based on 1 Customer Validation
BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.
Background
BGLAP protein, in its carboxylated form, plays a crucial role in the bone matrix by acting as a negative regulator of bone formation while maintaining bone resorption and mineralization. This form exhibits strong binding affinity to apatite and calcium. On the other hand, the uncarboxylated form functions as a hormone secreted by osteoblasts and regulates various cellular processes including energy metabolism, male fertility, and brain development. In terms of energy metabolism, it promotes pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Additionally, the uncarboxylated osteocalcin hormone stimulates testosterone production in the testes by acting as a ligand for G protein-coupled receptor GPRC6A on Leydig cells, resulting in the activation of CREB-dependent pathways required for testosterone synthesis. Furthermore, this hormone serves as a regulator of brain development by crossing the blood-brain barrier and binding to GPR158 on neurons. This interaction prevents neuronal apoptosis in the hippocampus, promotes the synthesis of monoamine neurotransmitters, and inhibits the synthesis of gamma-aminobutyric acid (GABA). Notably, osteocalcin also crosses the placenta during pregnancy, and maternal osteocalcin is necessary for fetal brain development.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-GST
-
Accession
P04640 (Y50-V99)
-
Molecular Construction
-
N-term
-
GST
-
BGLAP (Y50-V99)
Accession # P04640 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BGLAP; BGP; Bone Gamma-Carboxyglutamate Protein; Bone Gla Protein; Gamma-Carboxyglutamic Acid-Containing Protein; Bone Gamma-Carboxyglutamate (Gla) Protein (Osteocalcin); Osteocalcin; Bone Gamma-Carboxyglutamate (Gla) Protein; OCN; OC
-
AA Sequence
YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
-
Predicted Molecular Mass
32.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)