BOC Protein, Human (HEK293, His)
Based on 1 Customer Validation
BOC Protein, Human (HEK293, His) is a recombinant human BOC produced in HEK293 cells. BOC is a receptor-like protein that, with the related factor CDO, belongs to a newly recognized subfamily within the immunoglobulin superfamily of cell-surface molecules. BOC and CDO form complexes that positively regulate myogenesis in vitro.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BOC Protein, Human (HEK293, His) is a recombinant human BOC produced in HEK293 cells. BOC is a receptor-like protein that, with the related factor CDO, belongs to a newly recognized subfamily within the immunoglobulin superfamily of cell-surface molecules. BOC and CDO form complexes that positively regulate myogenesis in vitro[1].
Background
BOC is a member of the Ig/FNIII repeat family of receptor-like proteins. BOC has a four Ig plus three FNIII structure in its ectodomain, but is much more closely related to CDO at the amino acid level than are the Robo axon guidance receptors, despite the latter sharing a 5 + 3 structure with CDO[2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96DN7 (D31-S157)
-
Molecular Construction
-
N-term
-
BOC (A30-S157)
Accession # Q96DN7 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BOC; CDNA FLJ31797 Fis, Clone NT2RI2008942, Weakly Similar To NEURAL CELL ADHESION MOLECULE L1; BOC Cell Adhesion Associated, Oncogene Regulated; Boc Homolog (Mouse), Isoform CRA_b; Brother Of CDO; Boc Homolog (Mouse); CDON2; Boc Homolog; Boi; Protein BOC
-
AA Sequence
DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 20-38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized after extensive dialysis against PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)