BOC Protein, Human (HEK293, His)

BOC Protein, Human (HEK293, His) is a recombinant human BOC produced in HEK293 cells. BOC is a receptor-like protein that, with the related factor CDO, belongs to a newly recognized subfamily within the immunoglobulin superfamily of cell-surface molecules. BOC and CDO form complexes that positively regulate myogenesis in vitro^[1].

BOC is a member of the Ig/FNIII repeat family of receptor-like proteins. BOC has a four Ig plus three FNIII structure in its ectodomain, but is much more closely related to CDO at the amino acid level than are the Robo axon guidance receptors, despite the latter sharing a 5 + 3 structure with CDO^[2].

Human

HEK293

C-6*His

Q96DN7 (D31-S157)

91653  [NCBI]

Full Length of Mature Protein

ADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSHHHHHH

Approximately 20-38 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kang JS, et al. BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation. EMBO J. 2002;21(1-2):114-124.  [Content Brief]

  [2]. Mulieri PJ, et al. Expression of the boc gene during murine embryogenesis. Dev Dyn. 2002;223(3):379-388.  [Content Brief]