1. Recombinant Proteins
  2. Others
  3. BPIFA2 Protein, Human (HEK293, Fc)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, Fc) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, Fc) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

BPIFA2 protein, also known as bactericidal/permeability-increasing fold-containing family A member 2, exhibits remarkable antibacterial activity, specifically against Pseudomonas aeruginosa. This protein has the ability to effectively combat bacterial infections caused by Pseudomonas aeruginosa, a pathogenic bacterium known to be resistant to many antibiotics. The potent antibacterial activity of BPIFA2 protein suggests its potential as a therapeutic agent or as a target for the development of novel antibacterial strategies against Pseudomonas aeruginosa infections. Further exploration is required to fully understand the underlying mechanisms of action and the potential clinical applications of BPIFA2 protein.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q96DR5 (E19-I249)

Gene ID
Molecular Construction
N-term
BPIFA2 (E19-I249)
Accession # Q96DR5
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
BPI fold-containing family A member 2; PSP; C20orf70; SPLUNC2
AA Sequence

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Predicted Molecular Mass
51.8 kDa
Molecular Weight

Approximately 59 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BPIFA2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BPIFA2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BPIFA2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76749
Quantity:
MCE Japan Authorized Agent: