BPIFA2 Protein, Human (HEK293, Fc)
The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, Fc) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, Fc) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
BPIFA2 protein, also known as bactericidal/permeability-increasing fold-containing family A member 2, exhibits remarkable antibacterial activity, specifically against Pseudomonas aeruginosa. This protein has the ability to effectively combat bacterial infections caused by Pseudomonas aeruginosa, a pathogenic bacterium known to be resistant to many antibiotics. The potent antibacterial activity of BPIFA2 protein suggests its potential as a therapeutic agent or as a target for the development of novel antibacterial strategies against Pseudomonas aeruginosa infections. Further exploration is required to fully understand the underlying mechanisms of action and the potential clinical applications of BPIFA2 protein.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q96DR5 (E19-I249)
-
Molecular Construction
-
N-term
-
BPIFA2 (E19-I249)
Accession # Q96DR5 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BPIFA2; BA49G10.1; Prev. C20orf70; BPI Fold-Containing Family A Member 2; SPLUNC2; Parotid Secretory Protein; PSP; Chromosome 20 Open Reading Frame 70; BPI Fold Containing Family A Member 2; Short Palate, Lung And Nasal Epithelium Carcinoma-Associated Pro
-
AA Sequence
ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
-
Predicted Molecular Mass
51.8 kDa
-
Molecular Weight
Approximately 59 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
