BTN3A1/CD277 Protein, Human (Biotinylated, HEK293, Fc-Avi)
BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
The BTN3A1/CD277 protein is involved in crucial functions related to T-cell activation and the adaptive immune response. It acts as a regulator of activated T-cell proliferation and controls the release of cytokines and IFNG by these cells. Additionally, it plays a role in mediating the response of T-cells towards infected and transformed cells that exhibit elevated levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. The BTN3A1/CD277 protein functions as a homodimer.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
O00481-1 (Q30-G254)
-
Molecular Construction
-
N-term
-
BTN3A1 (Q30-G254)
Accession # O00481-1 -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
BTN3A1; CD277; Butyrophilin Subfamily 3 Member A1; DJ45P21.3 (Butyrophilin, Subfamily 3, Member A1); BTF5; Butyrophilin, Subfamily 3, Member A1; BTN3.1; CD277 Antigen; BT3.1
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
-
Predicted Molecular Mass
52.6 kDa
-
Molecular Weight
Approximately 58-62 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)