C-MPL Protein, Rat (sf9, His)
The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (sf9, His) is the recombinant rat-derived C-MPL protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (sf9, His) is the recombinant rat-derived C-MPL protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The thrombopoietin receptor, also known as myeloproliferative leukemia protein or CD110 (differentiated cluster 110), is a protein encoded in humans by the myeloproliferative leukemia virus oncogene. C-MPL can activate thrombopoietin receptors, participate in bone marrow cell homeostasis, and platelet aggregation and actively regulate the process of platelet formation. C-MPL is involved in the phosphorylation of JAK/STAT/MAPK family proteins. C-MPL is a biomarker for thrombocytopenia[1][2][3].
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
A0A1W2Q6N1/XP_001072502.1 (Q22-A500)
-
Molecular Construction
-
N-term
-
C-MPL (Q22-A500)
Accession # A0A1W2Q6N1/XP_001072502.1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MPL; Myeloproliferative Leukemia Virus Oncogene; MPL Proto-Oncogene, Thrombopoietin Receptor; TPO-R; TPOR; Thrombopoietin Receptor Variant; Myeloproliferative Leukemia Protein; CD110 Antigen; Thrombopoietin Receptor; THCYT2; Proto-Oncogene C-Mpl; C-MPL; C
-
AA Sequence
QVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSWIYQLLYAYPGEKPRPCPLHSQSVPTFGTRYVCQFPALDEVRLFFPLHLWVKNVFLNQTLMQRVLFVDTVGLPAPPSVIKARGGSQPGELQIHWEAPAPEISNFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLRMPNPVRVLDQHPCVHPTASQQHGPMRTSPAGEAPSLAVKGGSCLISGLHAGQSYWLQLRSQPDGVSLRGSWGPWSLPVTVDLPGDAVAIGLQCFTVDLKKVICQWQQQDHSSSRGFFRHSRTRCCPTDRDPTWEKCEEEEEEEEEEKEEGELDPGSRPALFSRCHFKSRNDSVIHILVEVTTAQGAIHSYLGSPFWIRQAVLLPTPSLHWREISSGRLELEWQHPSPWAAQETCYQLRYTGEGHEDWKVLEPSLGAQGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETA
-
Predicted Molecular Mass
55.1 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
