1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Stem Cell CD Proteins Platelet CD Proteins
  4. TPO-R/CD110
  5. C-MPL Protein, Rat (sf9, His)

The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (sf9, His) is the recombinant rat-derived C-MPL protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (sf9, His) is the recombinant rat-derived C-MPL protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The thrombopoietin receptor, also known as myeloproliferative leukemia protein or CD110 (differentiated cluster 110), is a protein encoded in humans by the myeloproliferative leukemia virus oncogene. C-MPL can activate thrombopoietin receptors, participate in bone marrow cell homeostasis, and platelet aggregation and actively regulate the process of platelet formation. C-MPL is involved in the phosphorylation of JAK/STAT/MAPK family proteins. C-MPL is a biomarker for thrombocytopenia[1][2][3].

Species

Rat

Source

Sf9 insect cells

Tag

C-His

Accession

A0A1W2Q6N1/XP_001072502.1 (Q22-A500)

Gene ID
Molecular Construction
N-term
C-MPL (Q22-A500)
Accession # A0A1W2Q6N1/XP_001072502.1
His
C-term
Protein Length

Extracellular Domain

Synonyms
CD110; c-Mpl; MPL; MPLV; Thrombopoietin R; TPO-R
AA Sequence

QVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSWIYQLLYAYPGEKPRPCPLHSQSVPTFGTRYVCQFPALDEVRLFFPLHLWVKNVFLNQTLMQRVLFVDTVGLPAPPSVIKARGGSQPGELQIHWEAPAPEISNFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLRMPNPVRVLDQHPCVHPTASQQHGPMRTSPAGEAPSLAVKGGSCLISGLHAGQSYWLQLRSQPDGVSLRGSWGPWSLPVTVDLPGDAVAIGLQCFTVDLKKVICQWQQQDHSSSRGFFRHSRTRCCPTDRDPTWEKCEEEEEEEEEEKEEGELDPGSRPALFSRCHFKSRNDSVIHILVEVTTAQGAIHSYLGSPFWIRQAVLLPTPSLHWREISSGRLELEWQHPSPWAAQETCYQLRYTGEGHEDWKVLEPSLGAQGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETA

Predicted Molecular Mass
55.1 kDa
Molecular Weight

Approximately 55 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

C-MPL Protein, Rat (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C-MPL Protein, Rat (sf9, His)
Cat. No.:
HY-P74243
Quantity:
MCE Japan Authorized Agent: