CALML3 Protein, Human (GST)
The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.
The CALML3 protein appears to serve a dual role by functioning as a specific light chain for unconventional myosin-10 (MYO10) and enhancing MYO10 translation. Acting potentially as a chaperone, CALML3 aids in the synthesis of the emerging MYO10 heavy chain protein. Furthermore, CALML3 exhibits the capacity to compete with calmodulin for binding to cellular substrates, suggesting a regulatory role in calcium-dependent signaling pathways. Particularly, its interaction with MYO10 is calcium-dependent and proves essential for MYO10 function in the extension of filopodia—a crucial process for cellular morphology. The intricate interplay between CALML3 and MYO10 underscores its significance in regulating cytoskeletal dynamics and cellular functions, prompting further investigation into the precise molecular mechanisms underlying these interactions and their functional consequences.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P27482 (M1-K149)
-
Molecular Construction
-
N-term
-
GST
-
CALML3 (M1-K149)
Accession # P27482 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CALML3; Calmodulin-Like Protein 3; Calmodulin Like 3; CaM-Like Protein; CLP; Calmodulin-Like 3; Calmodulin-Related Protein NB-1
-
AA Sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
-
Predicted Molecular Mass
43.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
