Carbonic Anhydrase 10 Protein, Human (HEK293)
Carbonic anhydrase 10 (CA10) protein, contrary to its name, lacks catalytic activity. This property distinguishes CA10 from typical carbonic anhydrases, which are known for their ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 10 Protein, Human (HEK293 ) is the recombinant human-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carbonic anhydrase 10 (CA10) protein, contrary to its name, lacks catalytic activity. This property distinguishes CA10 from typical carbonic anhydrases, which are known for their ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 10 Protein, Human (HEK293 ) is the recombinant human-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with tag free.
Background
Carbonic Anhydrase 10 (CA10) protein, based on available information, does not exhibit catalytic activity. In contrast to typical carbonic anhydrases that participate in the reversible hydration of carbon dioxide, CA10 appears to lack this enzymatic function. The absence of catalytic activity suggests that CA10 may have a distinct role, possibly serving as a structural protein or participating in non-enzymatic cellular processes. Further research is required to uncover the specific molecular functions and physiological implications associated with CA10, shedding light on its unique contributions within cellular pathways. Understanding the functional characteristics of CA10, especially in the context of its non-catalytic nature, is essential for unraveling its role in biological processes and potential relevance to health and disease. (
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q9NS85-1 (Q22-N300)
-
Molecular Construction
-
N-term
-
CA10 (Q22-N300)
Accession # Q9NS85-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CA10; Carbonic Anhydrase-Related Protein X; Carbonic Anhydrase 10 (Inactive); Carbonic Anhydrase X; Carbonic Anhydrase-Related Protein 10; CA-RP X; Carbonic Anhydrase 10; CARP X; HUCEP-15; Epididymis Secretory Sperm Binding Protein; CA-RPX; Cerebral Prote
-
AA Sequence
QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN
-
Predicted Molecular Mass
27.2 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
