Copy Link Print Information

Carbonic Anhydrase 2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Carbonic Anhydrase 2 Protein is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Mutations in CA2 are linked to osteopetrosis and renal tubular acidosis. The gene exhibits biased expression in various tissues, notably in the stomach and colon. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Carbonic Anhydrase 2 Protein, Mouse (HEK293, His)
  • Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Carbonic Anhydrase 2 Protein is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Mutations in CA2 are linked to osteopetrosis and renal tubular acidosis. The gene exhibits biased expression in various tissues, notably in the stomach and colon. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Carbonic Anhydrase 2 (CA2) is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Dysregulation of this enzyme is linked to conditions such as osteopetrosis and renal tubular acidosis. Two transcript variants encoding distinct isoforms have been identified. In addition to its fundamental role in carbon dioxide metabolism, the protein exhibits biased expression in various tissues, with notable levels in the stomach and colon, as well as eight other tissues. It can also hydrate cyanamide to urea. CA2 is essential for bone resorption and osteoclast differentiation. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Moreover, CA2 downregulation promoted HCC metastasis and invasion. It serves as a suppressor of HCC metastasis and EMT and is correlated with favorable overall survival (OS) in HCC patients[1][2][3][4].

Verified Bioactivity

Measured by its esterase activity. The specific activity is > 400 pmol/min/µg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    AAH55291 (S2-K260)

  • Gene ID
    12349  [NCBI]
  • Molecular Construction
    • N-term
    • CA2 (S2-K260)
      Accession # AAH55291
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CA2; CAC; Carbonic Anhydrase 2; Epididymis Secretory Protein Li 282; Carbonic Anhydrase II; Epididymis Luminal Protein 76; CA-II; Carbonic Anhydrase B; Carbonate Dehydratase II; Carbonic Dehydratase; Cyanamide Hydratase CA2; Carbonic Anhydrase; CAII; HEL-

  • AA Sequence

    SHHWGYSKHNGPENWHKDFPIANGDRQSPVDIDTATAHHDPALQPLLISYDKAASKSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEGDAEEAMVDNWRPAQPLKNRKIKASFK

  • Predicted Molecular Mass

    30 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Carbonic Anhydrase 2 Protein, Mouse (HEK293, His)
  • Carbonic Anhydrase 2 Protein, Mouse (HEK293, His) Product Image