Caveolin-1/CAV1 Protein, Human (Cell-Free, His)
Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.
Background
Caveolin-1/CAV1 protein serves as a pivotal scaffolding component within caveolar membranes, as demonstrated by its interactions and functional associations. It forms a stable heterooligomeric complex with CAV2, directing its localization to lipid rafts and driving the formation of caveolae. In addition to its role in membrane organization, CAV1 mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae, contributing to the complexity of cellular signaling. This multifunctional protein directly interacts with G-protein alpha subunits, regulating their activity and playing a role in the costimulatory signal crucial for T-cell receptor (TCR)-mediated T-cell activation. The binding of CAV1 to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Moreover, CAV1 recruits CTNNB1 to caveolar membranes, potentially modulating CTNNB1-mediated signaling through the Wnt pathway. Notably, CAV1 negatively regulates TGFB1-mediated activation of SMAD2/3 by facilitating the internalization of TGFBR1 from membrane rafts, leading to subsequent degradation. Through homooligomerization and diverse interactions with proteins like GLIPR2, NOSTRIN, SNAP25, STX1A, DPP4, CTNNB1, CDH1, JUP, PACSIN2, SLC7A9, BMX, BTK, TGFBR1, CAVIN3, EHD2, UBXN6, VCP, ABCG1, NEU3, and SPRY family members, CAV1 orchestrates a spectrum of cellular functions, including membrane dynamics, signaling regulation, cholesterol homeostasis, and lysosomal targeting.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q03135 (M1-I178)
-
Gene ID857
-
Protein Length
Full Length
-
Synonyms
CAV1; Caveolin; Prev. CAV; BSCL3; Caveolin 1, Caveolae Protein, 22kDa; LCCNS; Caveolin-1; VIP21; Caveolin 1, Caveolae Protein, 22kD; CGL3; Cell Growth-Inhibiting Protein 32; PPH3; Alternative Protein CAV1; Caveolin 1; MSTP085
-
AA Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)