Caveolin-1/CAV1 Protein, Human (Cell-Free, His)

Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.

Background

Caveolin-1/CAV1 protein serves as a pivotal scaffolding component within caveolar membranes, as demonstrated by its interactions and functional associations. It forms a stable heterooligomeric complex with CAV2, directing its localization to lipid rafts and driving the formation of caveolae. In addition to its role in membrane organization, CAV1 mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae, contributing to the complexity of cellular signaling. This multifunctional protein directly interacts with G-protein alpha subunits, regulating their activity and playing a role in the costimulatory signal crucial for T-cell receptor (TCR)-mediated T-cell activation. The binding of CAV1 to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Moreover, CAV1 recruits CTNNB1 to caveolar membranes, potentially modulating CTNNB1-mediated signaling through the Wnt pathway. Notably, CAV1 negatively regulates TGFB1-mediated activation of SMAD2/3 by facilitating the internalization of TGFBR1 from membrane rafts, leading to subsequent degradation. Through homooligomerization and diverse interactions with proteins like GLIPR2, NOSTRIN, SNAP25, STX1A, DPP4, CTNNB1, CDH1, JUP, PACSIN2, SLC7A9, BMX, BTK, TGFBR1, CAVIN3, EHD2, UBXN6, VCP, ABCG1, NEU3, and SPRY family members, CAV1 orchestrates a spectrum of cellular functions, including membrane dynamics, signaling regulation, cholesterol homeostasis, and lysosomal targeting.

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    CAV1; Caveolin; Prev. CAV; BSCL3; Caveolin 1, Caveolae Protein, 22kDa; LCCNS; Caveolin-1; VIP21; Caveolin 1, Caveolae Protein, 22kD; CGL3; Cell Growth-Inhibiting Protein 32; PPH3; Alternative Protein CAV1; Caveolin 1; MSTP085

  • AA Sequence

    MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

  • Predicted Molecular Mass

    22 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00