CCL11 Protein, Rhesus macaque (His)
Based on 1 Customer Validation
The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rhesus Macaque
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag.
Background
In response to the presence of allergens, the CCL11 protein plays a direct role in promoting the accumulation of eosinophils, which is a prominent characteristic of allergic inflammatory reactions, while showing no significant effect on lymphocytes, macrophages, or neutrophils. This selective recruitment underscores CCL11's specificity in orchestrating immune responses, particularly in the context of allergic reactions. The protein achieves this effect by binding to CCR3, emphasizing its engagement with specific receptors to regulate the migration and activation of eosinophils in response to allergenic stimuli.
Verified Bioactivity
Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 2.326 ng/mL, corresponding to a specific activity is 4.30×105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rhesus Macaque
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8MIT7 (G24-P97)
-
Molecular Construction
-
N-term
-
6*His
-
CCL11 (G24-P97)
Accession # Q8MIT7 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL11; Eosinophil Chemotactic Protein; Prev. SCYA11; MGC22554; Eotaxin; Small-Inducible Cytokine A11; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 11 (Eotaxin); C-C Motif Chemokine 11; Chemokine (C-C Motif) Ligand 11; C-C Motif Chemokine; C-C Mo
-
AA Sequence
GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP
-
Predicted Molecular Mass
8.4 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
