CCR6 Protein, Mouse (Cell-Free, His)

The CCR6 protein is a receptor for CCL20 and increases intracellular calcium levels upon ligand binding. Notably, CCR6 also acts as a receptor for non-chemokine ligands such as β-defensins (DEFB1, DEFB4, DEFB4A/B). CCR6 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR6 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The CCR6 protein is a receptor for CCL20 and increases intracellular calcium levels upon ligand binding. Notably, CCR6 also acts as a receptor for non-chemokine ligands such as β-defensins (DEFB1, DEFB4, DEFB4A/B). CCR6 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR6 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Background

The CCR6 Protein acts as a receptor for the C-C type chemokine CCL20, transducing signals by increasing intracellular calcium ion levels upon binding to its major ligand. Notably, CCR6 can also function as a receptor for non-chemokine ligands, such as beta-defensins, including DEFB1, DEFB4, and DEFB4A/B. The interaction between CCR6 and DEFB1 is crucial for regulating sperm motility and bactericidal activity. Additionally, CCR6 plays a pivotal role in chemotaxis, being responsible for the migration of dendritic cells, effector/memory T-cells, and B-cells, particularly at skin and mucosal surfaces under various conditions, including inflammation and pathology such as cancer and autoimmune diseases. CCR6-mediated signals are essential for immune responses in the intestinal mucosa, modulating inflammatory responses to tissue insult and trauma. Moreover, CCR6 is indispensable for recruiting pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to sites of inflammation, influencing thymocyte precursor migration events, B-cell localization in Peyers-patches, and the efficient secondary recall response of memory B-cells. It also positively regulates sperm motility and chemotaxis through its binding to CCL20.

Technical Parameters

  • Species Mouse
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • CCR6 (M1-M367)
      Accession # O54689
    • C-term
  • Protein Length

    Full length

  • Synonyms

    CCR6; LARC Receptor; Prev. STRL22; CC-CKR-6; CKR-L3; GPRCY4; CMKBR6; DRY-6; GPR29; CCR-6; GPR-CY4; CKRL3; CD196; DRY6; DCR2; Seven-Transmembrane Receptor, Lymphocyte, 22; BN-1; G Protein-Coupled Receptor 29; Chemokine (C-C Motif) Receptor 6; G-Protein Coupled Receptor 29; C-C Chemokine Receptor Type 6; Chemokine (C-C) Receptor 6; Chemokine Receptor-Like 3; CD196 Antigen; C-C Motif Chemokine Receptor 6; C-C CKR-6

  • AA Sequence

    MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVENDNASSFTM

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00