CCR6 Protein, Mouse (Cell-Free, His)
The CCR6 protein is a receptor for CCL20 and increases intracellular calcium levels upon ligand binding. Notably, CCR6 also acts as a receptor for non-chemokine ligands such as β-defensins (DEFB1, DEFB4, DEFB4A/B). CCR6 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR6 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CCR6 protein is a receptor for CCL20 and increases intracellular calcium levels upon ligand binding. Notably, CCR6 also acts as a receptor for non-chemokine ligands such as β-defensins (DEFB1, DEFB4, DEFB4A/B). CCR6 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR6 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Background
The CCR6 Protein acts as a receptor for the C-C type chemokine CCL20, transducing signals by increasing intracellular calcium ion levels upon binding to its major ligand. Notably, CCR6 can also function as a receptor for non-chemokine ligands, such as beta-defensins, including DEFB1, DEFB4, and DEFB4A/B. The interaction between CCR6 and DEFB1 is crucial for regulating sperm motility and bactericidal activity. Additionally, CCR6 plays a pivotal role in chemotaxis, being responsible for the migration of dendritic cells, effector/memory T-cells, and B-cells, particularly at skin and mucosal surfaces under various conditions, including inflammation and pathology such as cancer and autoimmune diseases. CCR6-mediated signals are essential for immune responses in the intestinal mucosa, modulating inflammatory responses to tissue insult and trauma. Moreover, CCR6 is indispensable for recruiting pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to sites of inflammation, influencing thymocyte precursor migration events, B-cell localization in Peyers-patches, and the efficient secondary recall response of memory B-cells. It also positively regulates sperm motility and chemotaxis through its binding to CCL20.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
O54689 (M1-M367)
-
Gene ID12458
-
Molecular Construction
-
N-term
-
10*His
-
CCR6 (M1-M367)
Accession # O54689 -
C-term
-
-
Protein Length
Full length
-
Synonyms
CCR6; LARC Receptor; Prev. STRL22; CC-CKR-6; CKR-L3; GPRCY4; CMKBR6; DRY-6; GPR29; CCR-6; GPR-CY4; CKRL3; CD196; DRY6; DCR2; Seven-Transmembrane Receptor, Lymphocyte, 22; BN-1; G Protein-Coupled Receptor 29; Chemokine (C-C Motif) Receptor 6; G-Protein Coupled Receptor 29; C-C Chemokine Receptor Type 6; Chemokine (C-C) Receptor 6; Chemokine Receptor-Like 3; CD196 Antigen; C-C Motif Chemokine Receptor 6; C-C CKR-6
-
AA Sequence
MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVENDNASSFTM
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)