CD14 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (HEK293, Fc) is the recombinant human-derived CD14 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (HEK293, Fc) is the recombinant human-derived CD14 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD14 serves as a crucial coreceptor for bacterial lipopolysaccharide (LPS), playing a pivotal role in the innate immune response to microbial pathogens. In collaboration with LBP, CD14 binds monomeric LPS and facilitates its delivery to the LY96/TLR4 complex, initiating downstream signaling events. This process involves the activation of MyD88, TIRAP, and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response. Additionally, CD14 acts as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively, with these clusters triggering signaling and subsequently translocating to the Golgi in a lipid-raft dependent pathway. CD14's interaction with electronegative LDL (LDL(-)) contributes to the cytokine release induced by LDL(-). CD14 is an integral component of the lipopolysaccharide (LPS) receptor complex, collaborating with LY96 and TLR4. Furthermore, it interacts with various partners, such as LPS-bound LBP, LPAR1, MYO18A, and FSTL1, underscoring its multifaceted role in immune responses and lipid metabolism.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CD14 (T20-C352)
      Accession # P08571
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen

  • AA Sequence

    TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC

  • Predicted Molecular Mass

    62.4 kDa

  • Molecular Weight

    Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00