CD14 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (HEK293, Fc) is the recombinant human-derived CD14 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (HEK293, Fc) is the recombinant human-derived CD14 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CD14 serves as a crucial coreceptor for bacterial lipopolysaccharide (LPS), playing a pivotal role in the innate immune response to microbial pathogens. In collaboration with LBP, CD14 binds monomeric LPS and facilitates its delivery to the LY96/TLR4 complex, initiating downstream signaling events. This process involves the activation of MyD88, TIRAP, and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response. Additionally, CD14 acts as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively, with these clusters triggering signaling and subsequently translocating to the Golgi in a lipid-raft dependent pathway. CD14's interaction with electronegative LDL (LDL(-)) contributes to the cytokine release induced by LDL(-). CD14 is an integral component of the lipopolysaccharide (LPS) receptor complex, collaborating with LY96 and TLR4. Furthermore, it interacts with various partners, such as LPS-bound LBP, LPAR1, MYO18A, and FSTL1, underscoring its multifaceted role in immune responses and lipid metabolism.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
P08571 (T20-C352)
-
Molecular Construction
-
N-term
-
hFc
-
CD14 (T20-C352)
Accession # P08571 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen
-
AA Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
-
Predicted Molecular Mass
62.4 kDa
-
Molecular Weight
Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)