CD14 Protein, Rat (HEK293, Fc)
The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD14 Protein functions as a coreceptor for bacterial lipopolysaccharide (LPS), forming a multi-protein complex with LY96 and TLR4. Collaborating with LBP, it binds monomeric LPS and delivers it to the LY96/TLR4 complex, initiating the innate immune response. CD14's involvement extends to TLR2:TLR6 and TLR2:TLR1 heterodimers, responding to diacylated and triacylated lipopeptides, respectively. Through interactions with MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, leading to cytokine secretion and inflammation. Additionally, it participates in LDL(-)-induced cytokine release and interacts with LPAR1, MYO18A, and FSTL1, highlighting its diverse roles in immune and signaling pathways.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q63691 (M1-Y341)
-
Molecular Construction
-
N-term
-
CD14 (M1-Y341)
Accession # Q63691 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen
-
AA Sequence
MKLMLGLLLLPLTLVHASPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAY
-
Predicted Molecular Mass
62.2 kDa
-
Molecular Weight
Approximately 72 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
