CD160 Protein, Mouse (HEK293, Fc)
CD160 is a diverse immune cell receptor that regulates activation and differentiation through stimulatory or inhibitory signaling. It exists in GPI-anchored and transmembrane form and initiates different pathways in NK and T cells. CD160 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD160 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD160 is a diverse immune cell receptor that regulates activation and differentiation through stimulatory or inhibitory signaling. It exists in GPI-anchored and transmembrane form and initiates different pathways in NK and T cells. CD160 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD160 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD160, a versatile receptor on immune cells, orchestrates stimulatory or inhibitory signals crucial for regulating cell activation and differentiation. It exhibits dual forms—GPI-anchored and transmembrane—each presumably initiating distinct signaling pathways. In activated NK cells, CD160 triggers phosphoinositol 3-kinase pathways, while in activated T cells, it engages LCK and CD247/CD3 zeta chain signaling. CD160 serves as a receptor for both classical and non-classical MHC class I molecules, contributing to the intricate regulation of immune responses. Additionally, it functions as a receptor or ligand for TNFRSF14, enabling bidirectional cell-cell contact signaling between antigen-presenting cells and lymphocytes. Upon TNFRSF14 ligation, CD160 provides a stimulatory signal to NK cells, enhancing IFNG production and bolstering anti-tumor immune responses. Conversely, on activated CD4+ T cells, CD160 interacts with TNFRSF14 to down-regulate CD28 costimulatory signaling, thereby constraining memory and alloantigen-specific immune responses. In the context of bacterial infection, CD160 acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and pro-inflammatory cytokines. The soluble GPI-cleaved form, often released by activated lymphocytes, likely plays an immune regulatory role by limiting lymphocyte effector functions.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
NP_061237.3/O88875 (G28-S160)
-
Molecular Construction
-
N-term
-
CD160 (G28-S160)
Accession # O88875 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55
-
AA Sequence
GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS
-
Predicted Molecular Mass
41.9 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)