CD160 Protein, Mouse (HEK293, Fc)

CD160 is a diverse immune cell receptor that regulates activation and differentiation through stimulatory or inhibitory signaling. It exists in GPI-anchored and transmembrane form and initiates different pathways in NK and T cells. CD160 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD160 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD160 is a diverse immune cell receptor that regulates activation and differentiation through stimulatory or inhibitory signaling. It exists in GPI-anchored and transmembrane form and initiates different pathways in NK and T cells. CD160 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD160 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD160, a versatile receptor on immune cells, orchestrates stimulatory or inhibitory signals crucial for regulating cell activation and differentiation. It exhibits dual forms—GPI-anchored and transmembrane—each presumably initiating distinct signaling pathways. In activated NK cells, CD160 triggers phosphoinositol 3-kinase pathways, while in activated T cells, it engages LCK and CD247/CD3 zeta chain signaling. CD160 serves as a receptor for both classical and non-classical MHC class I molecules, contributing to the intricate regulation of immune responses. Additionally, it functions as a receptor or ligand for TNFRSF14, enabling bidirectional cell-cell contact signaling between antigen-presenting cells and lymphocytes. Upon TNFRSF14 ligation, CD160 provides a stimulatory signal to NK cells, enhancing IFNG production and bolstering anti-tumor immune responses. Conversely, on activated CD4+ T cells, CD160 interacts with TNFRSF14 to down-regulate CD28 costimulatory signaling, thereby constraining memory and alloantigen-specific immune responses. In the context of bacterial infection, CD160 acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and pro-inflammatory cytokines. The soluble GPI-cleaved form, often released by activated lymphocytes, likely plays an immune regulatory role by limiting lymphocyte effector functions.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD160 (G28-S160)
      Accession # O88875
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55

  • AA Sequence

    GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS

  • Predicted Molecular Mass

    41.9 kDa

  • Molecular Weight

    Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00