CD162/PSGL-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (HEK293, His) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (HEK293, His) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD162/PSGL-1 Protein is a SLe(x)-type proteoglycan that plays a crucial role in inflammation. It facilitates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation by interacting with E-, P-, and L-selectins through high affinity, calcium-dependent interactions. CD162/PSGL-1 Protein is essential for the initial capture of leukocytes. In addition to its role in inflammation, it also acts as a receptor for enterovirus 71 during microbial infection.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q14242-1 (L18-G295)
-
Molecular Construction
-
N-term
-
PSGL-1 (L18-G295)
Accession # Q14242-1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain (with Propeptide)
-
Synonyms
SELPLG; Cutaneous Lymphocyte-Associated Associated Antigen; Selectin P Ligand; CD162 Antigen; PSGL-1; PSGL1; CD162; CLA; P-Selectin Glycoprotein Ligand 1
-
AA Sequence
LQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG
-
Predicted Molecular Mass
30.5 kDa
-
Molecular Weight
Approximately 89 kDa & 61 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
