CD164 Protein, Mouse (HEK293, Fc)
CD164 Protein, a sialomucin, actively promotes hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration, facilitating myoblast fusion into myotubes. CD164 also interacts with CXCR4, underlining its significant role in muscle development and function. CD164 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD164 Protein, a sialomucin, actively promotes hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration, facilitating myoblast fusion into myotubes. CD164 also interacts with CXCR4, underlining its significant role in muscle development and function. CD164 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD164 protein, a sialomucin, potentially plays a significant role in hematopoiesis and is implicated in cell adhesion. It is known to promote myogenesis by enhancing CXCR4-dependent cell motility and positively regulates myoblast migration, facilitating the fusion of myoblasts into myotubes. CD164 protein also interacts with CXCR4, further highlighting its involvement in cellular processes related to muscle development and function.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9R0L9 (Q24-D162)
-
Molecular Construction
-
N-term
-
CD164 (Q24-D162)
Accession # Q9R0L9 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD164; Endolyn; CD164 Molecule; DFNA66; MGC-24v; CD164 Antigen, Sialomucin; MUC-24; Deafness, Autosomal Dominant 66; MGC-24; CD164 Molecule, Sialomucin; Multi-Glycosylated Core Protein 24; CD164 Variant C; Sialomucin Core Protein 24; CD164 Antigen
-
AA Sequence
QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD
-
Predicted Molecular Mass
41.4 kDa
-
Molecular Weight
Approximately 70-115 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
