CD19 Protein, Cynomolgus/Rhesus Macaque (CHO, hFc)
CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (CHO, hFc) is the recombinant rhesus macaque/cynomolgus-derived CD19 protein, expressed by CHO, with C-hFc labeled tag.
- Species: Rhesus Macaque; Cynomolgus
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (CHO, hFc) is the recombinant rhesus macaque/cynomolgus-derived CD19 protein, expressed by CHO, with C-hFc labeled tag.
Background
CD19 is a signaling component of the B-cell receptor complex and a regulator that drives B-cell differentiation and germinal center (GC) formation by lowering the threshold for antigen-driven activation. CD19 forms a complex with multiple membrane proteins, including complement receptor type 2 (CD21) and tetraspanin (CD81), thereby lowering the threshold for antigen-primed B cell activation. The CD19 complex then activates the phosphatidylinositol 3-kinase signaling pathway and subsequently releases intracellular stored calcium ions. CD19 is used in chimeric antigen receptor (CAR) T cells to treat lymphocytic leukemia. Anti-CD19 CAR-T cell approaches have been used to treat B-cell malignancies and play a key role in systemic lupus erythematosus (SLE), where B-cell activation is dysregulated. CD19 also has a biological relationship with coronaviruses and may be involved in immune responses or antiviral activities.
Technical Parameters
-
Species Rhesus Macaque; Cynomolgus
-
Source CHO
-
Tag C-hFc
-
Accession
XP_005591597.1/F7F486 (P20-K292)
-
Gene ID102145514/705211
-
Molecular Construction
-
N-term
-
CD19 (P20-K292)
Accession # XP_005591597.1/F7F486 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD19; CDNA FLJ60916, Highly Similar To B-Lymphocyte Antigen CD19; CD19 Molecule; CDNA FLJ54955, Highly Similar To B-Lymphocyte Antigen CD19; B-Lymphocyte Surface Antigen B4; CD19 Antigen, Isoform CRA_f; T-Cell Surface Antigen Leu-12; CD19 Antigen, Isoform
-
AA Sequence
PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK
-
Predicted Molecular Mass
56.5 kDa
-
Molecular Weight
Approximately 80-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Jin X, et al. Therapeutic efficacy of anti-CD19 CAR-T cells in a mouse model of systemic lupus erythematosus. Cell Mol Immunol. 2021 Aug;18(8):1896-1903. [Content Brief]
[2]. Atkinson JR, et al. Protective Humoral Immunity in the Central Nervous System Requires Peripheral CD19-Dependent Germinal Center Formation following Coronavirus Encephalomyelitis. J Virol. 2017 Nov 14;91(23):e01352-17. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
