CD19 Protein, Cynomolgus/Rhesus Macaque (CHO, hFc)

CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (CHO, hFc) is the recombinant rhesus macaque/cynomolgus-derived CD19 protein, expressed by CHO, with C-hFc labeled tag.

CD19 is a signaling component of the B-cell receptor complex and a regulator that drives B-cell differentiation and germinal center (GC) formation by lowering the threshold for antigen-driven activation. CD19 forms a complex with multiple membrane proteins, including complement receptor type 2 (CD21) and tetraspanin (CD81), thereby lowering the threshold for antigen-primed B cell activation. The CD19 complex then activates the phosphatidylinositol 3-kinase signaling pathway and subsequently releases intracellular stored calcium ions. CD19 is used in chimeric antigen receptor (CAR) T cells to treat lymphocytic leukemia. Anti-CD19 CAR-T cell approaches have been used to treat B-cell malignancies and play a key role in systemic lupus erythematosus (SLE), where B-cell activation is dysregulated. CD19 also has a biological relationship with coronaviruses and may be involved in immune responses or antiviral activities.

Rhesus Macaque; Cynomolgus

CHO

C-hFc

XP_005591597.1/F7F486 (P20-K292)

102145514/705211

Partial

PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

Approximately 80-95 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jin X, et al. Therapeutic efficacy of anti-CD19 CAR-T cells in a mouse model of systemic lupus erythematosus. Cell Mol Immunol. 2021 Aug;18(8):1896-1903.  [Content Brief]

  [2]. Atkinson JR, et al. Protective Humoral Immunity in the Central Nervous System Requires Peripheral CD19-Dependent Germinal Center Formation following Coronavirus Encephalomyelitis. J Virol. 2017 Nov 14;91(23):e01352-17.  [Content Brief]