CD3 epsilon Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD3 ε protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When APC is activated, TCR signals transmitted by CD3D, CD3E, CD3G, and CD3Z initiate pathways through ITAM. CD3 epsilon Protein, Canine (HEK293, His) is the recombinant canine-derived CD3 epsilon protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD3 ε protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When APC is activated, TCR signals transmitted by CD3D, CD3E, CD3G, and CD3Z initiate pathways through ITAM. CD3 epsilon Protein, Canine (HEK293, His) is the recombinant canine-derived CD3 epsilon protein, expressed by HEK293, with C-His labeled tag.

Background

The CD3 epsilon protein is an integral component of the TCR-CD3 complex located on the T-lymphocyte cell surface, playing a pivotal role in adaptive immune responses. When activated by antigen-presenting cells (APCs), the T-cell receptor (TCR) initiates signaling pathways transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G, and CD3Z, all of which contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these ITAMs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, activating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3E is indispensable for proper T-cell development and plays a crucial role in initiating TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. CD3E also participates in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers that associate with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimer to complete the TCR-CD3 complex, with the flexibility for TCRalpha and TCRbeta substitution by TCRgamma and TCRdelta. CD3E further interacts with CD6, NCK1, and NUMB, the latter being crucial for TCR-CD3 internalization and subsequent degradation. This intricate network underscores the multifunctional role of CD3E in orchestrating T-cell responses.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD3 epsilon (Q22-L122)
      Accession # P27597
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD3E; T3E; CD3 Epsilon Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3; T-Cell Surface Glycoprotein CD3 Epsilon Chain; CD3e Molecule; CD3-Epsilon; CD3e Antigen; CD3epsilon; CD3E Protein; CD3e Antigen, Epsilon Pol

  • AA Sequence

    QDEDFKASDDLTSISPEKRFKVSISGTEVVVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYLRARVCANCIEVNL

  • Predicted Molecular Mass

    16.7 kDa

  • Molecular Weight

    Approximately 19-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00