Copy Link Print Information

CD300c Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD300c protein, also known as CMRF35 antigen, was identified using a monoclonal antibody. It is present on immune cells like monocytes, neutrophils, and certain T and B lymphocytes, as documented by Jackson et al. in 1992. The protein is broadly expressed in various tissues, including the lung, appendix, and 19 other tissues. CD300c Protein, Human (HEK293, His) is the recombinant human-derived CD300c protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD300c Protein, Human (HEK293, His)
  • Experimental Validation Results for CD300c Protein, Human (HEK293, His)
  • CD300c Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD300c protein, also known as CMRF35 antigen, was identified using a monoclonal antibody. It is present on immune cells like monocytes, neutrophils, and certain T and B lymphocytes, as documented by Jackson et al. in 1992. The protein is broadly expressed in various tissues, including the lung, appendix, and 19 other tissues. CD300c Protein, Human (HEK293, His) is the recombinant human-derived CD300c protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD300c protein, also known as the CMRF35 antigen, has been identified through reactivity with a monoclonal antibody. This antigen is found on various immune cells, including monocytes, neutrophils, and certain T and B lymphocytes, as documented in a study by Jackson et al. in 1992. The protein exhibits broad expression across multiple tissues, with notable presence in lung, appendix, and 19 other tissues.

Verified Bioactivity

Measured by its ability to inhibit anti-CD3-induced proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 3.884 μg/ml, corresponding to a specific activity is 257.47 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit anti-CD3-induced proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 3.884 μg/mL, corresponding to a specific activity is 257.47 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q08708/NP_006669.1 (M29-R183)

  • Gene ID
    10871  [NCBI]
  • Molecular Construction
    • N-term
    • CD300c (M29-R183)
      Accession # Q08708/NP_006669.1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CD300C; CMRF35-Like Molecule 6; CD300c Molecule; CMRF35-A1; CMRF35A; CMRF35A1; CMRF35; CMRF-35; IGSF16; CLM-6; CD300c Antigen; CMRF35A Leukocyte Immunoglobulin-Like Receptor; CMRF-35A; CMRF35 Leukocyte Immunoglobulin-Like Receptor; LIR; CMRF35 Antigen; Im

  • AA Sequence

    MTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

  • Molecular Weight

    Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit anti-CD3-induced proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 3.884 μg/mL, corresponding to a specific activity is 257.47 units/mg.

  • CD300c Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD300c Protein, Human (HEK293, His)
  • Experimental Validation Results for CD300c Protein, Human (HEK293, His)
  • CD300c Protein, Human (HEK293, His) Product Image