CD300LF Protein, Human (His)
Based on 1 Customer Validation
The CD300LF protein acts as a multifunctional immunomodulator, acting as an inhibitory receptor on myeloid cells and mast cells. It plays a vital role in immune homeostasis by actively regulating the phagocytosis of apoptotic cells by binding to phosphatidylserine. CD300LF Protein, Human (His) is the recombinant human-derived CD300LF protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD300LF protein acts as a multifunctional immunomodulator, acting as an inhibitory receptor on myeloid cells and mast cells. It plays a vital role in immune homeostasis by actively regulating the phagocytosis of apoptotic cells by binding to phosphatidylserine. CD300LF Protein, Human (His) is the recombinant human-derived CD300LF protein, expressed by E. coli , with N-6*His labeled tag.
Background
CD300LF protein serves as a multifaceted regulator within the immune system, acting as an inhibitory receptor for myeloid cells and mast cells. It plays a pivotal role in immune homeostasis by positively regulating the phagocytosis of apoptotic cells, or efferocytosis, through recognition and binding to phosphatidylserine (PS) on the surface of apoptotic cells. CD300LF also functions as a negative regulator of Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin. Furthermore, it may act as a coreceptor for interleukin 4 (IL-4), enhancing IL-4- and IL-13-induced signaling (By similarity). CD300LF negatively regulates Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through the activation of phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Additionally, it inhibits osteoclast formation and induces macrophage cell death upon engagement (By similarity). The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8TDQ1-1 (T20-S156)
-
Molecular Construction
-
N-term
-
6*His
-
CD300LF (T20-S156)
Accession # Q8TDQ1-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD300LF; NK Inhibitory Receptor; CD300 Molecule Like Family Member F; IREM-1; IGSF13; CLM-1; IREM1; CD300 Molecule-Like Family Member F; NKIR; CD300 Antigen Like Family Member F; CLM1; Immunoglobin Superfamily Member 13; CD300f; Inhibitory Receptor IREM1;
-
AA Sequence
TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
-
Predicted Molecular Mass
19.5 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)