CD300LF Protein, Human (His)

CD300LF Protein functions as a versatile immune regulator, acting as an inhibitory receptor for myeloid and mast cells. It plays a crucial role in immune homeostasis by positively regulating apoptotic cell phagocytosis through binding to phosphatidylserine. CD300LF also acts as a negative regulator of mast cell activation and allergic responses by binding to ceramide and sphingomyelin. It may enhance IL-4 and IL-13 signaling and negatively regulates TLR signaling. Additionally, CD300LF inhibits osteoclast formation and induces macrophage cell death. CD300LF Protein, Human (His) is the recombinant human-derived CD300LF protein, expressed by E. coli, with N-6*His labeled tag. The total length of CD300LF Protein, Human (His) is 137 a.a., with molecular weight of ~21 kDa.

CD300LF protein serves as a multifaceted regulator within the immune system, acting as an inhibitory receptor for myeloid cells and mast cells. It plays a pivotal role in immune homeostasis by positively regulating the phagocytosis of apoptotic cells, or efferocytosis, through recognition and binding to phosphatidylserine (PS) on the surface of apoptotic cells. CD300LF also functions as a negative regulator of Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin. Furthermore, it may act as a coreceptor for interleukin 4 (IL-4), enhancing IL-4- and IL-13-induced signaling (By similarity). CD300LF negatively regulates Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through the activation of phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Additionally, it inhibits osteoclast formation and induces macrophage cell death upon engagement (By similarity). The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R (By similarity).

Human

E. coli

N-6*His

Q8TDQ1 (20T-156S)

146722  [NCBI]

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Approximately 21 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.