Copy Link Print Information

CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His)
  • CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division[3]. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His) is 172 amino acids in length (Q63-D234) and is expressed in the HEK293 cells with a N-terminal His-tag.

Background

CD30 Ligand (CD30L) is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1].
CD30L is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family, structurally related to tumour necrosis superfamily members TNF alpha, TNF beta, and CD40[1][3].
CD30L enhances cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines to play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. CD30L also enhances release of cytokine IL-6, TNF, LT-a[2].
CD30L exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division regulation[3].
CD30L is mainly expressed on activated T cells, B cells, macrophages and DCs, while CD30/CD30L mainly expressed on the surface of activated CD4+ T cells in the lamina propria (LP), especially at the early stage of Th17 cell differentiation. CD30L deficiency could inhibit Th17 cell differentiation and production of IL-17A in the intestinal mucosa[4].
CD30L acts as a pro-inflammatory cytokines, is involved in the adaptive immune response in ulcerative colitis (UC), the level of which shows positive correlation with the severity of UC[5].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD30L at 10 μg/mL (100 μ L/well) can bind biotinylated human CD30. The ED50 for this effect is 3.499 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD30L at 10 μg/mL (100 μL/well) can bind biotinylated human CD30. The ED50 for this effect is 3.499 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-His
  • Accession

    G7P2F1 (Q63-D234)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • His
    • CD30L (Q63-D234)
      Accession # G7P2F1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF8; CD153 Antigen; Prev. CD30LG; CD30-L; Tumor Necrosis Factor Ligand Superfamily Member 8; CD30L; CD30 Ligand; Tumor Necrosis Factor Superfamily Member 8; CD153; Tumor Necrosis Factor Ligand 3A; Tumor Necrosis Factor (Ligand) Superfamily, Member 8; C

  • AA Sequence

    QRTDSIPNSPDNIPLRGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTVSVNVDTFQYIDTSTFPLENVLSVFLYSNSD

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cerutti A, et al. CD30 is a CD40-inducible molecule that negatively regulates CD40-mediated immunoglobulin class switching in non-antigen-selected human B cells. Immunity. 1998 Aug;9(2):247-56. [Content Brief]

[2]. Gruss H-J, et al. CD30 ligand, a member of the TNF ligand superfamily, with growth and activation control CD30+ lymphoid and lymphoma cells. Leuk Lymphoma. 1996 Feb;20(5-6):397-409. [Content Brief]

[3]. Pera MF, et al. CD30 and its ligand: possible role in regulation of teratoma stem cells. APMIS. 1998 Jan;106(1):169-72; discussion 173. [Content Brief]

[4]. Wang X, et al. CD30L/CD30 signaling regulates the formation of the tumor immune microenvironment and inhibits intestinal tumor development of colitis-associated colon cancer in mice. Int Immunopharmacol. 2020 Jul;84:106531. [Content Brief]

[5]. Mei C, et al. CD30L+ classical monocytes play a pro-inflammatory role in the development of ulcerative colitis in patients. Mol Immunol. 2021 Oct;138:10-19. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD30L at 10 μg/mL (100 μL/well) can bind biotinylated human CD30. The ED50 for this effect is 3.499 ng/mL.

  • CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His)
  • CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, His) Product Image