Fc gamma RIIA/CD32a Protein, Human (183a.a, H167R, HEK293, His)

Customer Review

Based on 1 Customer Validation

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (H167R, HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167R mutation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (H167R, HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167R mutation.

Background

The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.

Verified Bioactivity

Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.7182 μg/mL, corresponding to a specific activity is 1.39×10^3 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.7182 μg/mL, corresponding to a specific activity is 1.39×103 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD32a (A36-I218, H167R)
      Accession # AAA35827.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FCGR2A; Fc Fragment Of IgG, Low Affinity IIa, Receptor (CD32); Prev. FCGR2A1; Fc Fragment Of IgG Receptor IIa; Prev. FCG2; IgG Fc Receptor II-A; Prev. FCGR2; FcRII-A; Fc-Gamma-RIIa; Fc Fragment Of IgG, Low Affinity IIa, Receptor For (CD32); IGFR2; Fc Gamm

  • AA Sequence

    AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGII

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00