CD37 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Human (HEK293, Fc) is the recombinant human-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Human (HEK293, Fc) is the recombinant human-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
P11049 (A113-N240)
-
Molecular Construction
-
N-term
-
hFc
-
CD37 (A113-N240)
Accession # P11049 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD37; Tspan-26; CD37 Molecule; CDNA FLJ25364 Fis, Clone TST01761, Highly Similar To LEUKOCYTE ANTIGEN CD37; TSPAN26; Cell Differentiation Antigen 37; Leukocyte Antigen CD37; Leukocyte Surface Antigen CD37; Tetraspanin-26; Tetraspanin; CD37 Antigen; GP52-4
-
AA Sequence
AQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
-
Predicted Molecular Mass
41.9 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)