CD37 Protein, Human (HEK293, Fc)

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Human (HEK293, Fc) is the recombinant human-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag.

CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.

Human

HEK293

N-hFc

P11049 (A113-N240)

951  [NCBI]

Extracellular Domain

AQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN

50-60 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.