CD43 Protein, Mouse (HEK293, His)
CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CD43 protein in mice emerges as the predominant cell surface sialoprotein of leukocytes, wielding a regulatory influence over various T-cell functions crucial to immune responses. CD43 positively regulates T-cell activation, proliferation, differentiation, trafficking, and migration, particularly enhancing T-cell trafficking to lymph nodes through its interaction with ERM proteins (EZR, RDX, and MSN). In addition to negatively regulating Th2 cell differentiation, CD43 steers T-cells towards a Th1 lineage commitment. It plays a pivotal role in inducing the expression of IFN-gamma during T-cell receptor (TCR) activation, affecting both CD4(+) and CD8(+) T-cells, and contributes to T-cell preparation for cytokine sensing and differentiation into effector cells by influencing the expression of cytokine receptors IFNGR and IL4R. Serving as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and subsequent recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 acts as a T-cell counter-receptor for SIGLEC1 and exhibits a protective role by shielding cells from apoptotic signals, thus promoting cell survival.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
P15702 (D20-G248)
-
Molecular Construction
-
N-term
-
CD43 (D20-G248)
Accession # P15702 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SPN; LSN; Sialophorin; Sialophorin (GpL115, Leukosialin, CD43); GPL115; Leukocyte Sialoglycoprotein; CD43; Galactoglycoprotein; Leukosialin; GALGP; LEU-22; CD43 Antigen
-
AA Sequence
DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG
-
Predicted Molecular Mass
23.6 kDa
-
Molecular Weight
Approximately 80-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)