CD59 Protein, Rat (HEK293, Fc)
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD59 Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, exerting its regulatory influence at or after the C5b-8 stage of MAC assembly. This key role positions CD59 as a crucial modulator in the complement system, preventing excessive activation and the subsequent membrane damage associated with uncontrolled MAC formation. By targeting specific stages of the MAC assembly process, CD59 plays a pivotal role in maintaining the delicate balance of complement activation, highlighting its significance in the immune response and safeguarding cellular integrity from complement-mediated damage.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
P27274 (L23-N100)
-
Molecular Construction
-
N-term
-
CD59 (L23-N100)
Accession # P27274 -
hFc
-
C-term
-
-
Protein Length
Full Length of CD59 glycoprotein Chain
-
Synonyms
CD59; CD59 Molecule, Complement Regulatory Protein; Prev. HRF20; CD59 Blood Group Antigen; Prev. MACIF; MAC-Inhibitory Protein; Prev. MIC11; MEM43 Antigen; Prev. MSK21; 1F5 Antigen; Prev. MIN1; HRF-20; Prev. MIN2; MAC-IP; Prev. MIN3; Surface Anitgen Recog
-
AA Sequence
LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 40 kDa & 43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
