CD59a Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD59a Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, functioning by binding to the C8 and/or C9 complements during the assembling MAC. Through this interaction, CD59a prevents the incorporation of multiple copies of C9 essential for the complete formation of the osmolytic pore. This regulatory role underscores the crucial contribution of CD59a in modulating the complement system, specifically at the level of MAC assembly, and serves as a pivotal safeguard mechanism against the uncontrolled formation of the osmolytic pore, ultimately protecting cells from potential complement-mediated damage.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
O55186/NP_001104530.1 (L24-K95)
-
Molecular Construction
-
N-term
-
CD59a (L24-K95)
Accession # O55186/NP_001104530.1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CD59; CD59 Molecule, Complement Regulatory Protein; Prev. HRF20; CD59 Blood Group Antigen; Prev. MACIF; MAC-Inhibitory Protein; Prev. MIC11; MEM43 Antigen; Prev. MSK21; 1F5 Antigen; Prev. MIN1; HRF-20; Prev. MIN2; MAC-IP; Prev. MIN3; Surface Anitgen Recog
-
AA Sequence
LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNK
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
