CD94 Protein, Human (HEK293, His-Avi)

CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-Avi, N-His labeled tag.

CD94 Protein, an immune receptor crucial for self-nonself discrimination, forms a complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and other non-classical MHC class Ib molecules. This interaction enables cytotoxic cells to monitor MHC class I expression in healthy cells, fostering self-tolerance. Primarily serving as a ligand-binding subunit without the capacity to signal, the KLRD1-KLRC1 complex acts as an immune inhibitory receptor, with CD94 playing a key inhibitory role on natural killer (NK) cells. CD94 dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells to prevent autoimmunity. On intraepithelial CD8-positive gamma-delta regulatory T cells, CD94 triggers TGFB1 secretion, limiting the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, CD94 acts as an immune inhibitory checkpoint, potentially contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a state known as cell exhaustion. Upon HLA-E-peptide binding, CD94 transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, ultimately opposing signals from activating receptors by dephosphorylating proximal signaling molecules.

Human

HEK293

N-Avi;N-8*His

Q13241-1 (S34-I179)

3824  [NCBI]

Extracellular Domain

SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Approximately 38-42 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.