Chemerin/RARRES2 Protein, Human (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Chemerin/RARRES2 protein, an adipocyte-secreted adipokine, intricately regulates adipogenesis, metabolism, and inflammation by activating the chemokine-like receptor 1 (CMKLR1) and also functioning as a ligand for CMKLR2. While it can bind to C-C chemokine receptor-like 2 (CCRL2) with lower affinity than CMKLR1 or CMKLR2, its primary role involves positive regulation of adipocyte differentiation and modulation of adipocyte gene expression related to lipid and glucose metabolism. Additionally, Chemerin/RARRES2 plays a potential role in angiogenesis, a critical process for white adipose tissue expansion. Acting as a pro-inflammatory adipokine, it stimulates the secretion of pro-inflammatory and prodiabetic adipokines, adversely impacting adipose tissue metabolic function and leading to systemic effects such as impaired insulin sensitivity, altered glucose and lipid metabolism, and compromised vascular function in other tissues. The protein exhibits both pro- and anti-inflammatory properties based on enzymatic cleavage by different proteases, functioning as a chemotactic factor for leukocyte populations expressing CMKLR1 and exerting an anti-inflammatory role by inhibiting TNF/TNFA-induced VCAM1 expression in vascular endothelial cells. This dual role suggests a potential link between chronic inflammation, obesity, and associated disorders like type 2 diabetes and cardiovascular disease, while also exhibiting an antimicrobial function in the skin.

Verified Bioactivity

1. Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 for this effect is 7.695 ng/mL, corresponding to a specific activity is 1.3×105 units/mg.
2. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human ChemR23. The ED50 for this effect is 12.63 ng/mL, corresponding to a specific activity is 7.918×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 for this effect is 7.695 ng/mL, corresponding to a specific activity is 1.3×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Chemerin (E21-S157)
      Accession # Q99969
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RARRES2; HP10433; Retinoic Acid Receptor Responder 2; Retinoic Acid Receptor Responder (Tazarotene Induced) 2; Chemerin; Tazarotene-Induced Gene 2 Protein; TIG2; RAR-Responsive Protein TIG2; Retinoic Acid Receptor Responder Protein 2

  • AA Sequence

    ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00