CHODL Protein, Human (HEK293, Fc)
CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The CHODL protein appears to be involved in the development of the nervous system, particularly in processes such as neurite outgrowth and elongation. Its potential role suggests a contribution to the intricate mechanisms that govern the formation and extension of neuronal projections. Moreover, CHODL may participate in motor axon growth and guidance, indicating a broader influence on the establishment of neural circuits and connectivity. The interaction between CHODL and RABGGTB suggests a molecular partnership that could play a crucial role in mediating the cellular processes associated with CHODL's functions in nervous system development. Further exploration into the specific mechanisms and downstream effects of CHODL in neurite outgrowth, elongation, and motor axon growth could provide valuable insights into its role in shaping the structural and functional aspects of the developing nervous system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9H9P2-1 (R22-N216)
-
Molecular Construction
-
N-term
-
CHODL (R22-N216)
Accession # Q9H9P2-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CHODL; MT75; Prev. C21orf68; FLJ12627; PRED12; Chromosome 21 Open Reading Frame 68; Chondrolectin; Transmembrane Protein MT75
-
AA Sequence
RRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPN
-
Predicted Molecular Mass
48.7 kDa
-
Molecular Weight
Approximately 65-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
