1. Recombinant Proteins
  2. Others
  3. CHODL Protein, Human (HEK293, Fc)

CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CHODL protein appears to be involved in the development of the nervous system, particularly in processes such as neurite outgrowth and elongation. Its potential role suggests a contribution to the intricate mechanisms that govern the formation and extension of neuronal projections. Moreover, CHODL may participate in motor axon growth and guidance, indicating a broader influence on the establishment of neural circuits and connectivity. The interaction between CHODL and RABGGTB suggests a molecular partnership that could play a crucial role in mediating the cellular processes associated with CHODL's functions in nervous system development. Further exploration into the specific mechanisms and downstream effects of CHODL in neurite outgrowth, elongation, and motor axon growth could provide valuable insights into its role in shaping the structural and functional aspects of the developing nervous system.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9H9P2-1 (R22-N216)

Gene ID
Molecular Construction
N-term
CHODL (R22-N216)
Accession # Q9H9P2-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Chondrolectin; CHODL; C21orf68; 3110074E07Rik; MT75; PRED12; FLJ12627
AA Sequence

RRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPN

Predicted Molecular Mass
48.7 kDa
분자량

Approximately 65-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

CHODL Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CHODL Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CHODL Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77897
수량:
MCE Japan Authorized Agent: