1. Recombinant Proteins
  2. Others
  3. CHODL Protein, Human (HEK293, Fc)

CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CHODL protein contributes to nervous system development, affecting neurite outgrowth and motor axon growth. Interacting with RABGGTB, it plays a crucial role in cellular processes and neural circuit establishment. Investigating CHODL's mechanisms and effects in neurite outgrowth and motor axon growth can offer insights into its role in shaping the developing nervous system. CHODL Protein, Human (HEK293, Fc) is the recombinant human-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CHODL protein appears to be involved in the development of the nervous system, particularly in processes such as neurite outgrowth and elongation. Its potential role suggests a contribution to the intricate mechanisms that govern the formation and extension of neuronal projections. Moreover, CHODL may participate in motor axon growth and guidance, indicating a broader influence on the establishment of neural circuits and connectivity. The interaction between CHODL and RABGGTB suggests a molecular partnership that could play a crucial role in mediating the cellular processes associated with CHODL's functions in nervous system development. Further exploration into the specific mechanisms and downstream effects of CHODL in neurite outgrowth, elongation, and motor axon growth could provide valuable insights into its role in shaping the structural and functional aspects of the developing nervous system.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9H9P2-1 (R22-N216)

Gene ID
Molecular Construction
N-term
CHODL (R22-N216)
Accession # Q9H9P2-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Chondrolectin; CHODL; C21orf68; 3110074E07Rik; MT75; PRED12; FLJ12627
AA Sequence

RRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPN

Predicted Molecular Mass
48.7 kDa
Molecular Weight

Approximately 65-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHODL Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CHODL Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHODL Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77897
Quantity:
MCE Japan Authorized Agent: